Details of the Target
General Information of Target
| Target ID | LDTP07464 | |||||
|---|---|---|---|---|---|---|
| Target Name | Homeobox-containing protein 1 (HMBOX1) | |||||
| Gene Name | HMBOX1 | |||||
| Gene ID | 79618 | |||||
| Synonyms |
HOT1; TAH1; Homeobox-containing protein 1; Homeobox telomere-binding protein 1; Telomere-associated homeobox-containing protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK
FGRRSSYGGSSYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRE NNERLSTSNGKMSPTRYHANSMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAF LANRRISQAVVAQVTGISQSRISHWLLQQGSDLSEQKKRAFYRWYQLEKTNPGATLSMRP APIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLAVMESYFNENQYPDEAKREEI ANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILESHGIDVQSPGG HSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Binds directly to 5'-TTAGGG-3' repeats in telomeric DNA. Associates with the telomerase complex at sites of active telomere processing and positively regulates telomere elongation. Important for TERT binding to chromatin, indicating a role in recruitment of the telomerase complex to telomeres. Also plays a role in the alternative lengthening of telomeres (ALT) pathway in telomerase-negative cells where it promotes formation and/or maintenance of ALT-associated promyelocytic leukemia bodies (APBs). Enhances formation of telomere C-circles in ALT cells, suggesting a possible role in telomere recombination. Might also be involved in the DNA damage response at telomeres.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ONAyne Probe Info |
![]() |
K314(8.33) | LDD0274 | [1] | |
|
HHS-482 Probe Info |
![]() |
Y327(0.84) | LDD2239 | [2] | |
References


