Details of the Target
General Information of Target
| Target ID | LDTP07421 | |||||
|---|---|---|---|---|---|---|
| Target Name | Centriole, cilia and spindle-associated protein (CCSAP) | |||||
| Gene Name | CCSAP | |||||
| Gene ID | 126731 | |||||
| Synonyms |
C1orf96; CSAP; Centriole, cilia and spindle-associated protein |
|||||
| 3D Structure | ||||||
| Sequence |
MSPGSGVKSEYMKRYQEPRWEEYGPCYRELLHYRLGRRLLEQAHAPWLWDDWGPAGSSED
SASSESSGAGGPAPRCAPPSPPPPVEPATQEEAERRARGAPEEQDAEAGDAEAEDAEDAA LPALPVKDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSKIKEN KHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEKRKLVAQRQRAHS VDVEKNRKMKASSSENPWMTEYMRCYSARA |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CCSAP family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole
|
|||||
| Function |
Plays a role in microtubule (MT) stabilization and this stabilization involves the maintenance of NUMA1 at the spindle poles. Colocalizes with polyglutamylated MTs to promote MT stabilization and regulate bipolar spindle formation in mitosis. Binding of CCSAP to centrosomes and the spindle around centrosomes during mitosis inhibits MT depolymerization, thereby stabilizing the mitotic spindle. May play a role in embryonic development. May be required for proper cilia beating.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [1] | |
|
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [2] | |
References


