Details of the Target
General Information of Target
| Target ID | LDTP07389 | |||||
|---|---|---|---|---|---|---|
| Target Name | XIAP-associated factor 1 (XAF1) | |||||
| Gene Name | XAF1 | |||||
| Gene ID | 54739 | |||||
| Synonyms |
BIRC4BP; XIAPAF1; XIAP-associated factor 1; BIRC4-binding protein |
|||||
| 3D Structure | ||||||
| Sequence |
MEGDFSVCRNCKRHVVSANFTLHEAYCLRFLVLCPECEEPVPKETMEEHCKLEHQQVGCT
MCQQSMQKSSLEFHKANECQERPVECKFCKLDMQLSKLELHESYCGSRTELCQGCGQFIM HRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYCNQMIPENKYFHHMGKCCPDSEFKK HFPVGNPEILPSSLPSQAAENQTSTMEKDVRPKTRSINRFPLHSESSSKKAPRSKNKTLD PLLMSEPKPRTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNF S |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm; Nucleus
|
|||||
| Function |
Seems to function as a negative regulator of members of the IAP (inhibitor of apoptosis protein) family. Inhibits anti-caspase activity of BIRC4. Induces cleavage and inactivation of BIRC4 independent of caspase activation. Mediates TNF-alpha-induced apoptosis and is involved in apoptosis in trophoblast cells. May inhibit BIRC4 indirectly by activating the mitochondrial apoptosis pathway. After translocation to mitochondria, promotes translocation of BAX to mitochondria and cytochrome c release from mitochondria. Seems to promote the redistribution of BIRC4 from the cytoplasm to the nucleus, probably independent of BIRC4 inactivation which seems to occur in the cytoplasm. The BIRC4-XAF1 complex mediates down-regulation of BIRC5/survivin; the process requires the E3 ligase activity of BIRC4. Seems to be involved in cellular sensitivity to the proapoptotic actions of TRAIL. May be a tumor suppressor by mediating apoptosis resistance of cancer cells.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| EFO21 | SNV: p.P249S | . | |||
| KATOIII | SNV: p.R132S | . | |||
| NCIH1155 | SNV: p.M169I | . | |||
| NCIH358 | SNV: p.E162Ter | DBIA Probe Info | |||
| SHP77 | SNV: p.P212Q | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C50(1.90) | LDD3310 | [1] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [2] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [2] | |
Competitor(s) Related to This Target
References




