Details of the Target
General Information of Target
| Target ID | LDTP07374 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative histone H2B type 2-D (H2BC19P) | |||||
| Gene Name | H2BC19P | |||||
| Synonyms |
HIST2H2BD; Putative histone H2B type 2-D; H2B-clustered histone 19 pseudogene |
|||||
| 3D Structure | ||||||
| Sequence |
MPEPAKFAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKRVHPDTGIWCKAM
GIMNSFLNDIFERIAGEASRLAHYNKRSTITSRRSRRPCACCCPASWPSTPCPRAPRRSP STPAPSESLPGPGARSLPPSLPPRVAGCFVSKGSFQGHLTPLVK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H2B family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HHS-475 Probe Info |
![]() |
Y84(1.13) | LDD0264 | [1] | |
|
HHS-465 Probe Info |
![]() |
Y84(2.95) | LDD2237 | [2] | |
Competitor(s) Related to This Target
References


