Details of the Target

General Information of Target

Target ID LDTP07349
Target Name Keratin, type I cytoskeletal 40 (KRT40)
Gene Name KRT40
Gene ID 125115
Synonyms
KA36; Keratin, type I cytoskeletal 40; Cytokeratin-40; CK-40; Keratin-40; K40; Type I hair keratin Ka36
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTSDCSSTHCSPESCGTASGCAPASSCSVETACLPGTCATSRCQTPSFLSRSRGLTGCLL
PCYFTGSCNSPCLVGNCAWCEDGVFTSNEKETMQFLNDRLASYLEKVRSLEETNAELESR
IQEQCEQDIPMVCPDYQRYFNTIEDLQQKILCTKAENSRLAVQLDNCKLATDDFKSKYES
ELSLRQLLEADISSLHGILEELTLCKSDLEAHVESLKEDLLCLKKNHEEEVNLLREQLGD
RLSVELDTAPTLDLNRVLDEMRCQCETVLANNRREAEEWLAVQTEELNQQQLSSAEQLQG
CQMEILELKRTASALEIELQAQQSLTESLECTVAETEAQYSSQLAQIQCLIDNLENQLAE
IRCDLERQNQEYQVLLDVKARLEGEINTYWGLLDSEDSRLSCSPCSTTCTSSNTCEPCSA
YVICTVENCCL
Target Bioclass
Other
Family
Intermediate filament family
Function May play a role in late hair differentiation.
Uniprot ID
Q6A162
Ensemble ID
ENST00000377755.9
HGNC ID
HGNC:26707

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
N1
 Probe Info  		E111(0.00); E112(0.00); E116(0.00)  LDD0245  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 53 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3 beta-hydroxysteroid dehydrogenase type 7 (HSD3B7) 3-beta-HSD family Q9H2F3
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
26S proteasome regulatory subunit 8 (PSMC5) AAA ATPase family P62195
Paraplegin (SPG7) AAA ATPase family; Peptidase M41 family Q9UQ90
Aldehyde dehydrogenase family 3 member B1 (ALDH3B1) Aldehyde dehydrogenase family P43353
Malonate--CoA ligase ACSF3, mitochondrial (ACSF3) ATP-dependent AMP-binding enzyme family Q4G176
60 kDa heat shock protein, mitochondrial (HSPD1) Chaperonin (HSP60) family P10809
Phenylalanine--tRNA ligase, mitochondrial (FARS2) Class-II aminoacyl-tRNA synthetase family O95363
Alanine--glyoxylate aminotransferase (AGXT) Class-V pyridoxal-phosphate-dependent aminotransferase family P21549
Probable ATP-dependent RNA helicase DDX6 (DDX6) DEAD box helicase family P26196
Putative ATP-dependent RNA helicase DHX57 (DHX57) DEAD box helicase family Q6P158
Cryptochrome-2 (CRY2) DNA photolyase class-1 family Q49AN0
Dystrobrevin beta (DTNB) Dystrophin family O60941
Ribonuclease P/MRP protein subunit POP5 (POP5) Eukaryotic/archaeal RNase P protein component 2 family Q969H6
Peptidyl-prolyl cis-trans isomerase FKBP1B (FKBP1B) FKBP-type PPIase family P68106
Lysine-specific histone demethylase 1A (KDM1A) Flavin monoamine oxidase family O60341
Glucose-fructose oxidoreductase domain-containing protein 1 (GFOD1) Gfo/Idh/MocA family Q9NXC2
Histone deacetylase 4 (HDAC4) Histone deacetylase family P56524
Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 (INPP5D) Inositol 1,4,5-trisphosphate 5-phosphatase family Q92835
Protein mab-21-like 2 (MAB21L2) Mab-21 family Q9Y586
Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein (ASMTL) Maf family O95671
Methyltransferase-like protein 17, mitochondrial (METTL17) Rsm22 family Q9H7H0
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Cathepsin Z (CTSZ) Peptidase C1 family Q9UBR2
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
Ubiquitin carboxyl-terminal hydrolase 21 (USP21) Peptidase C19 family Q9UK80
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Proteasome subunit beta type-1 (PSMB1) Peptidase T1B family P20618
5'-AMP-activated protein kinase catalytic subunit alpha-1 (PRKAA1) CAMK Ser/Thr protein kinase family Q13131
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
Serine/threonine-protein kinase Nek6 (NEK6) NEK Ser/Thr protein kinase family Q9HC98
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Tyrosine-protein kinase receptor TYRO3 (TYRO3) Tyr protein kinase family Q06418
Non-receptor tyrosine-protein kinase TYK2 (TYK2) Tyr protein kinase family P29597
Tyrosine-protein kinase HCK (HCK) Tyr protein kinase family P08631
Tyrosine-protein kinase receptor Tie-1 (TIE1) Tyr protein kinase family P35590
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 (PTPMT1) Protein-tyrosine phosphatase family Q8WUK0
GTP-binding protein GEM (GEM) RGK family P55040
Ras-related C3 botulinum toxin substrate 1 (RAC1) Rho family P63000
Arylsulfatase I (ARSI) Sulfatase family Q5FYB1
Thioredoxin, mitochondrial (TXN2) Thioredoxin family Q99757
TNF receptor-associated factor 4 (TRAF4) TNF receptor-associated factor family Q9BUZ4
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
Cell division cycle protein 20 homolog B (CDC20B) WD repeat CDC20/Fizzy family Q86Y33
A disintegrin and metalloproteinase with thrombospondin motifs 1 (ADAMTS1) . Q9UHI8
Apoptosis-enhancing nuclease (AEN) . Q8WTP8
BRCA1-associated RING domain protein 1 (BARD1) . Q99728
Josephin-1 (JOSD1) . Q15040
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) . Q13526
Protein GUCD1 (GUCD1) . Q96NT3
RWD domain-containing protein 2B (RWDD2B) . P57060
Sulfite oxidase, mitochondrial (SUOX) . P51687
Transporter and channel
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Metal transporter CNNM3 (CNNM3) ACDP family Q8NE01
AP-1 complex subunit mu-1 (AP1M1) Adaptor complexes medium subunit family Q9BXS5
Cytochrome c (CYCS) Cytochrome c family P99999
Cytochrome c oxidase subunit 5A, mitochondrial (COX5A) Cytochrome c oxidase subunit 5A family P20674
Hemoglobin subunit alpha (HBA1; HBA2) Globin family P69905
Importin subunit alpha-1 (KPNA2) Importin alpha family P52292
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Aquaporin-5 (AQP5) MIP/aquaporin (TC 1.A.8) family P55064
Mitochondrial dicarboxylate carrier (SLC25A10) Mitochondrial carrier (TC 2.A.29) family Q9UBX3
Ninjurin-1 (NINJ1) Ninjurin family Q92982
Nuclear RNA export factor 1 (NXF1) NXF family Q9UBU9
Polycystin-2 (PKD2) Polycystin family Q13563
Transcription factor
Click To Hide/Show 54 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-B9 (HOXB9) Abd-B homeobox family P17482
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
REST corepressor 3 (RCOR3) CoREST family Q9P2K3
Doublesex- and mab-3-related transcription factor 3 (DMRT3) DMRT family Q9NQL9
Wilms tumor protein (WT1) EGR C2H2-type zinc-finger protein family P19544
Fez family zinc finger protein 1 (FEZF1) Krueppel C2H2-type zinc-finger protein family A0PJY2
Putative zinc finger protein 702 (ZNF702P) Krueppel C2H2-type zinc-finger protein family Q9H963
Vascular endothelial zinc finger 1 (VEZF1) Krueppel C2H2-type zinc-finger protein family Q14119
Zinc finger and BTB domain-containing protein 16 (ZBTB16) Krueppel C2H2-type zinc-finger protein family Q05516
Zinc finger and BTB domain-containing protein 24 (ZBTB24) Krueppel C2H2-type zinc-finger protein family O43167
Zinc finger and SCAN domain-containing protein 21 (ZSCAN21) Krueppel C2H2-type zinc-finger protein family Q9Y5A6
Zinc finger protein 1 homolog (ZFP1) Krueppel C2H2-type zinc-finger protein family Q6P2D0
Zinc finger protein 101 (ZNF101) Krueppel C2H2-type zinc-finger protein family Q8IZC7
Zinc finger protein 124 (ZNF124) Krueppel C2H2-type zinc-finger protein family Q15973
Zinc finger protein 17 (ZNF17) Krueppel C2H2-type zinc-finger protein family P17021
Zinc finger protein 20 (ZNF20) Krueppel C2H2-type zinc-finger protein family P17024
Zinc finger protein 230 (ZNF230) Krueppel C2H2-type zinc-finger protein family Q9UIE0
Zinc finger protein 26 (ZNF26) Krueppel C2H2-type zinc-finger protein family P17031
Zinc finger protein 266 (ZNF266) Krueppel C2H2-type zinc-finger protein family Q14584
Zinc finger protein 319 (ZNF319) Krueppel C2H2-type zinc-finger protein family Q9P2F9
Zinc finger protein 329 (ZNF329) Krueppel C2H2-type zinc-finger protein family Q86UD4
Zinc finger protein 337 (ZNF337) Krueppel C2H2-type zinc-finger protein family Q9Y3M9
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 438 (ZNF438) Krueppel C2H2-type zinc-finger protein family Q7Z4V0
Zinc finger protein 439 (ZNF439) Krueppel C2H2-type zinc-finger protein family Q8NDP4
Zinc finger protein 564 (ZNF564) Krueppel C2H2-type zinc-finger protein family Q8TBZ8
Zinc finger protein 569 (ZNF569) Krueppel C2H2-type zinc-finger protein family Q5MCW4
Zinc finger protein 575 (ZNF575) Krueppel C2H2-type zinc-finger protein family Q86XF7
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Zinc finger protein 625 (ZNF625) Krueppel C2H2-type zinc-finger protein family Q96I27
Zinc finger protein 655 (ZNF655) Krueppel C2H2-type zinc-finger protein family Q8N720
Zinc finger protein 69 homolog B (ZFP69B) Krueppel C2H2-type zinc-finger protein family Q9UJL9
Zinc finger protein 76 (ZNF76) Krueppel C2H2-type zinc-finger protein family P36508
Zinc finger protein 792 (ZNF792) Krueppel C2H2-type zinc-finger protein family Q3KQV3
Zinc finger protein 844 (ZNF844) Krueppel C2H2-type zinc-finger protein family Q08AG5
Zinc finger protein ZFP2 (ZFP2) Krueppel C2H2-type zinc-finger protein family Q6ZN57
Zinc finger and BTB domain-containing protein 42 (ZBTB42) Krueppel C2H2-type zinc-finger protein family B2RXF5
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
PHD finger protein 1 (PHF1) Polycomblike family O43189
Zinc finger protein SNAI1 (SNAI1) Snail C2H2-type zinc-finger protein family O95863
Teashirt homolog 3 (TSHZ3) Teashirt C2H2-type zinc-finger protein family Q63HK5
Endothelial transcription factor GATA-2 (GATA2) . P23769
Forkhead box protein B1 (FOXB1) . Q99853
Metastasis-associated protein MTA1 (MTA1) . Q13330
Myb-related transcription factor, partner of profilin (MYPOP) . Q86VE0
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1) . Q969G3
THAP domain-containing protein 7 (THAP7) . Q9BT49
Transcriptional enhancer factor TEF-3 (TEAD4) . Q15561
Zinc finger CCCH-type with G patch domain-containing protein (ZGPAT) . Q8N5A5
Zinc finger protein 202 (ZNF202) . O95125
Zinc finger protein 408 (ZNF408) . Q9H9D4
Zinc finger protein 580 (ZNF580) . Q9UK33
Zinc finger protein 581 (ZNF581) . Q9P0T4
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neuropeptides B/W receptor type 2 (NPBWR2) G-protein coupled receptor 1 family P48146
Immunoglobulin
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hyaluronan and proteoglycan link protein 2 (HAPLN2) HAPLN family Q9GZV7
Myeloid cell surface antigen CD33 (CD33) SIGLEC (sialic acid binding Ig-like lectin) family P20138
Semaphorin-4C (SEMA4C) Semaphorin family Q9C0C4
ADAMTS-like protein 3 (ADAMTSL3) . P82987
Cytokine and receptor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ciliary neurotrophic factor (CNTF) CNTF family P26441
Tumor necrosis factor ligand superfamily member 6 (FASLG) Tumor necrosis factor family P48023
Other
Click To Hide/Show 166 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Afadin- and alpha-actinin-binding protein (SSX2IP) ADIP family Q9Y2D8
Atos homolog protein A (ATOSA) ATOS family Q32MH5
ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) ATP12 family Q8N5M1
Protein BEX2 (BEX2) BEX family Q9BXY8
Bystin (BYSL) Bystin family Q13895
Ciliogenesis-associated TTC17-interacting protein (CATIP) CATIP family Q7Z7H3
Cilia- and flagella-associated protein 206 (CFAP206) CFAP206 family Q8IYR0
Cysteine-rich hydrophobic domain-containing protein 2 (CHIC2) CHIC family Q9UKJ5
EKC/KEOPS complex subunit LAGE3 (LAGE3) CTAG/PCC1 family Q14657
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
Cyclin-G1 (CCNG1) Cyclin family P51959
Dedicator of cytokinesis protein 2 (DOCK2) DOCK family Q92608
Dedicator of cytokinesis protein 8 (DOCK8) DOCK family Q8NF50
Eukaryotic translation initiation factor 4E type 2 (EIF4E2) Eukaryotic initiation factor 4E family O60573
Protein FAM124B (FAM124B) FAM124 family Q9H5Z6
Protein FAM27E3 (FAM27E3) FAM27 family Q08E93
Protein FAM74A4/A6 (FAM74A4; FAM74A6) FAM74 family Q5TZK3
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
F-box/WD repeat-containing protein 5 (FBXW5) FBXW5 family Q969U6
Radial spoke head 14 homolog (RSPH14) Flagellar radial spoke RSP14 family Q9UHP6
Protein FRG1 (FRG1) FRG1 family Q14331
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 (GNG5) G protein gamma family P63218
Guanine nucleotide-binding protein G(i) subunit alpha-2 (GNAI2) G-alpha family P04899
Golgi-associated RAB2 interactor protein 6 (GARIN6) GARIN family Q8NEG0
Hemoglobin subunit zeta (HBZ) Globin family P02008
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Heat shock 70 kDa protein 12B (HSPA12B) Heat shock protein 70 family Q96MM6
Inhibitor of growth protein 5 (ING5) ING family Q8WYH8
Keratin, type I cytoskeletal 20 (KRT20) Intermediate filament family P35900
Keratin, type II cuticular Hb1 (KRT81) Intermediate filament family Q14533
Keratin, type II cuticular Hb2 (KRT82) Intermediate filament family Q9NSB4
Keratin, type II cuticular Hb3 (KRT83) Intermediate filament family P78385
Keratin, type II cuticular Hb5 (KRT85) Intermediate filament family P78386
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin, type II cytoskeletal 2 epidermal (KRT2) Intermediate filament family P35908
Keratin, type II cytoskeletal 2 oral (KRT76) Intermediate filament family Q01546
Keratin, type II cytoskeletal 4 (KRT4) Intermediate filament family P19013
Keratin, type II cytoskeletal 5 (KRT5) Intermediate filament family P13647
Keratin, type II cytoskeletal 6A (KRT6A) Intermediate filament family P02538
Keratin, type II cytoskeletal 6B (KRT6B) Intermediate filament family P04259
Keratin, type II cytoskeletal 6C (KRT6C) Intermediate filament family P48668
Keratin, type II cytoskeletal 71 (KRT71) Intermediate filament family Q3SY84
Keratin, type II cytoskeletal 72 (KRT72) Intermediate filament family Q14CN4
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Keratin, type II cytoskeletal 8 (KRT8) Intermediate filament family P05787
Zinc finger protein 488 (ZNF488) Krueppel C2H2-type zinc-finger protein family Q96MN9
Late cornified envelope protein 3E (LCE3E) LCE family Q5T5B0
Lipase maturation factor 2 (LMF2) Lipase maturation factor family Q9BU23
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Microfibrillar-associated protein 1 (MFAP1) MFAP1 family P55081
MICOS complex subunit MIC19 (CHCHD3) MICOS complex subunit Mic19 family Q9NX63
Protein Mis18-beta (OIP5) Mis18 family O43482
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
MOB kinase activator 3C (MOB3C) MOB1/phocein family Q70IA8
Natriuretic peptides B (NPPB) Natriuretic peptide family P16860
Iron-sulfur cluster assembly enzyme ISCU (ISCU) NifU family Q9H1K1
Nuclear distribution protein nudE-like 1 (NDEL1) NudE family Q9GZM8
GPI transamidase component PIG-S (PIGS) PIGS family Q96S52
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
Ribosome-recycling factor, mitochondrial (MRRF) RRF family Q96E11
Disks large-associated protein 2 (DLGAP2) SAPAP family Q9P1A6
Short coiled-coil protein (SCOC) SCOC family Q9UIL1
Guanine nucleotide exchange factor for Rab-3A (RAB3IL1) SEC2 family Q8TBN0
Rab-3A-interacting protein (RAB3IP) SEC2 family Q96QF0
Shiftless antiviral inhibitor of ribosomal frameshifting protein (SHFL) SHFL family Q9NUL5
Pre-mRNA-splicing factor SLU7 (SLU7) SLU7 family O95391
Single-pass membrane and coiled-coil domain-containing protein 4 (SMCO4) SMCO4 family Q9NRQ5
SNW domain-containing protein 1 (SNW1) SNW family Q13573
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
Protein SSX2 (SSX2; SSX2B) SSX family Q16385
Translational activator of cytochrome c oxidase 1 (TACO1) TACO1 family Q9BSH4
Alpha-taxilin (TXLNA) Taxilin family P40222
Trichoplein keratin filament-binding protein (TCHP) TCHP family Q9BT92
General transcription factor 3C polypeptide 5 (GTF3C5) TFIIIC subunit 5 family Q9Y5Q8
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
Transmembrane protein 231 (TMEM231) TMEM231 family Q9H6L2
Centrosomal protein CEP57L1 (CEP57L1) Translokin family Q8IYX8
Centrosomal protein of 57 kDa (CEP57) Translokin family Q86XR8
Troponin T, slow skeletal muscle (TNNT1) Troponin T family P13805
Tetratricopeptide repeat protein 9C (TTC9C) TTC9 family Q8N5M4
Large ribosomal subunit protein uL11m (MRPL11) Universal ribosomal protein uL11 family Q9Y3B7
Large ribosomal subunit protein uL5 (RPL11) Universal ribosomal protein uL5 family P62913
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
UPF0561 protein C2orf68 (C2orf68) UPF0561 family Q2NKX9
rRNA-processing protein UTP23 homolog (UTP23) UTP23/FCF1 family Q9BRU9
Protein UXT (UXT) UXT family Q9UBK9
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
Zinc finger C2HC domain-containing protein 1C (ZC2HC1C) ZC2HC1 family Q53FD0
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Arginine vasopressin-induced protein 1 (AVPI1) . Q5T686
Armadillo repeat-containing protein 7 (ARMC7) . Q9H6L4
Axin-1 (AXIN1) . O15169
Break repair meiotic recombinase recruitment factor 1 (BRME1) . Q0VDD7
Bromo adjacent homology domain-containing 1 protein (BAHD1) . Q8TBE0
BTB/POZ domain-containing protein KCTD9 (KCTD9) . Q7L273
C-type lectin domain family 18 member A (CLEC18A) . A5D8T8
Caspase recruitment domain-containing protein 9 (CARD9) . Q9H257
Cation channel sperm-associated targeting subunit tau (C2CD6) . Q53TS8
Chromobox protein homolog 8 (CBX8) . Q9HC52
Coiled-coil domain-containing glutamate-rich protein 1 (CCER1) . Q8TC90
Coiled-coil domain-containing protein 112 (CCDC112) . Q8NEF3
Coiled-coil domain-containing protein 116 (CCDC116) . Q8IYX3
Coiled-coil domain-containing protein 185 (CCDC185) . Q8N715
Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 (CHCHD2) . Q9Y6H1
Collagen alpha-1(VIII) chain (COL8A1) . P27658
Doublecortin domain-containing protein 2B (DCDC2B) . A2VCK2
Elongin-A (ELOA) . Q14241
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
F-box only protein 34 (FBXO34) . Q9NWN3
Factor associated with metabolism and energy (CCDC198) . Q9NVL8
Fibronectin type III domain-containing protein 11 (FNDC11) . Q9BVV2
G patch domain-containing protein 2-like (GPATCH2L) . Q9NWQ4
Gametogenetin (GGN) . Q86UU5
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Inactive polyglycylase TTLL10 (TTLL10) . Q6ZVT0
INO80 complex subunit B (INO80B) . Q9C086
IQ motif and ubiquitin-like domain-containing protein (IQUB) . Q8NA54
Kelch-like protein 38 (KLHL38) . Q2WGJ6
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Leucine-rich repeat and calponin homology domain-containing protein 4 (LRCH4) . O75427
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
LIM domain transcription factor LMO4 (LMO4) . P61968
Mitogen-activated protein kinase-binding protein 1 (MAPKBP1) . O60336
Myelin-associated oligodendrocyte basic protein (MOBP) . Q13875
Neuronal migration protein doublecortin (DCX) . O43602
Outer dynein arm-docking complex subunit 4 (ODAD4) . Q96NG3
PDZ and LIM domain protein 5 (PDLIM5) . Q96HC4
PHD finger protein 21A (PHF21A) . Q96BD5
Phostensin (PPP1R18) . Q6NYC8
PML-RARA-regulated adapter molecule 1 (PRAM1) . Q96QH2
Protein lin-37 homolog (LIN37) . Q96GY3
Protein PIMREG (PIMREG) . Q9BSJ6
Protein SPMIP2 (SPMIP2) . Q96LM5
Putative ankyrin repeat domain-containing protein 26-like 1 (ANKRD36BP1) . Q96IX9
Putative uncharacterized protein C19orf73 (C19orf73) . Q9NVV2
Putative uncharacterized protein DKFZp434K191 . Q5BKY6
Putative uncharacterized protein MGC163334 . Q5W150
Putative Wilms tumor upstream neighbor 1 gene protein (WT1-AS) . Q06250
Ras association domain-containing protein 5 (RASSF5) . Q8WWW0
Receptor-transporting protein 5 (RTP5) . Q14D33
Rhombotin-1 (LMO1) . P25800
Rhombotin-2 (LMO2) . P25791
RNA-binding protein 41 (RBM41) . Q96IZ5
SCAN domain-containing protein 1 (SCAND1) . P57086
SH2 domain-containing protein 4A (SH2D4A) . Q9H788
SHC-transforming protein 3 (SHC3) . Q92529
Sperm flagellar protein 1 (SPEF1) . Q9Y4P9
SRA stem-loop-interacting RNA-binding protein, mitochondrial (SLIRP) . Q9GZT3
Tastin (TROAP) . Q12815
TBC1 domain family member 21 (TBC1D21) . Q8IYX1
TBC1 domain family member 22B (TBC1D22B) . Q9NU19
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
Tetratricopeptide repeat protein 23 (TTC23) . Q5W5X9
TNFAIP3-interacting protein 3 (TNIP3) . Q96KP6
Ubiquitin-associated and SH3 domain-containing protein A (UBASH3A) . P57075
Uncharacterized protein C10orf62 (C10orf62) . Q5T681
Uncharacterized protein C11orf87 (C11orf87) . Q6NUJ2
Uncharacterized protein C6orf226 (C6orf226) . Q5I0X4
Uncharacterized protein C8orf48 (C8orf48) . Q96LL4
Uncharacterized protein EXOC3-AS1 (EXOC3-AS1) . Q8N2X6
Uveal autoantigen with coiled-coil domains and ankyrin repeats (UACA) . Q9BZF9
WD repeat-containing protein 25 (WDR25) . Q64LD2
Zinc finger FYVE domain-containing protein 21 (ZFYVE21) . Q9BQ24
Zinc finger matrin-type protein 2 (ZMAT2) . Q96NC0

References

1 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.