Details of the Target

General Information of Target

Target ID LDTP07309
Target Name Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3)
Gene Name CREB3L3
Gene ID 84699
Synonyms
CREBH; Cyclic AMP-responsive element-binding protein 3-like protein 3; cAMP-responsive element-binding protein 3-like protein 3; Transcription factor CREB-H) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 3]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDS
DDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGK
GPCLSYHPGNSCSTTTPGPVIQVPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTV
KDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYE
ERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLL
EQLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPSISPFGPNKTESPGDFAPVRVFS
RTLHNDAASRVAADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDN
ATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL
Target Bioclass
Transcription factor
Family
BZIP family, ATF subfamily
Subcellular location
Nucleus; Endoplasmic reticulum membrane
Function
Transcription factor that may act during endoplasmic reticulum stress by activating unfolded protein response target genes. Activated in response to cAMP stimulation. In vitro, binds to the cAMP response element (CRE) and box-B element. Activates transcription through box-B element. Activates transcription through CRE. May function synergistically with ATF6. In acute inflammatory response, may activate expression of acute phase response (APR) genes. May be involved in growth suppression. Regulates FGF21 transcription. Plays a crucial role in the regulation of triglyceride metabolism and is required for the maintenance of normal plasma triglyceride concentrations.
Uniprot ID
Q68CJ9
Ensemble ID
ENST00000078445.7
HGNC ID
HGNC:18855

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CMK SNV: p.G121R .
COLO800 SNV: p.G35D .
IGR1 SNV: p.V170M .
LNCaP clone FGC SNV: p.S256L .
MCC13 SNV: p.R175Q .
MFE296 SNV: p.Q117R .
MFE319 SNV: p.M10I; p.A13T; p.R32P; p.G35R .
SUPT1 Deletion: p.L79RfsTer4
Insertion: p.G84VfsTer60		 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		N.A.  LDD0241  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0023  KB03 MDA-MB-231 C176(3.43)  LDD1701  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Lysosomal membrane ascorbate-dependent ferrireductase CYB561A3 (CYB561A3) . Q8NBI2
Transporter and channel
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Sodium-coupled neutral amino acid transporter 7 (SLC38A7) Amino acid/polyamine transporter 2 family Q9NVC3
Ammonium transporter Rh type A (RHAG) Ammonium transporter family Q02094
Membrane-spanning 4-domains subfamily A member 13 (MS4A13) MS4A family Q5J8X5
Syntaxin-5 (STX5) Syntaxin family Q13190
Zinc transporter ZIP9 (SLC39A9) ZIP transporter (TC 2.A.5) family Q9NUM3
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-dependent transcription factor ATF-6 alpha (ATF6) BZIP family P18850
Cyclic AMP-responsive element-binding protein 3 (CREB3) BZIP family O43889
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3) BZIP family Q68CJ9
Nuclear factor interleukin-3-regulated protein (NFIL3) BZIP family Q16649
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable G-protein coupled receptor 25 (GPR25) G-protein coupled receptor 1 family O00155
Other
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Centrosomal protein of 19 kDa (CEP19) CEP19 family Q96LK0
Protein dpy-30 homolog (DPY30) Dpy-30 family Q9C005
RUS family member 1 (RUSF1) RUS1 family Q96GQ5
Small glutamine-rich tetratricopeptide repeat-containing protein alpha (SGTA) SGT family O43765
Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB) SGT family Q96EQ0
Protein YIPF6 (YIPF6) YIP1 family Q96EC8
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0
Microspherule protein 1 (MCRS1) . Q96EZ8
TRAF3-interacting JNK-activating modulator (TRAF3IP3) . Q9Y228

References

1 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
2 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761