Details of the Target
General Information of Target
| Target ID | LDTP07309 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cyclic AMP-responsive element-binding protein 3-like protein 3 (CREB3L3) | |||||
| Gene Name | CREB3L3 | |||||
| Gene ID | 84699 | |||||
| Synonyms |
CREBH; Cyclic AMP-responsive element-binding protein 3-like protein 3; cAMP-responsive element-binding protein 3-like protein 3; Transcription factor CREB-H) [Cleaved into: Processed cyclic AMP-responsive element-binding protein 3-like protein 3]
|
|||||
| 3D Structure | ||||||
| Sequence |
MNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDS
DDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGK GPCLSYHPGNSCSTTTPGPVIQVPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTV KDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYE ERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLL EQLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPSISPFGPNKTESPGDFAPVRVFS RTLHNDAASRVAADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDN ATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
BZIP family, ATF subfamily
|
|||||
| Subcellular location |
Nucleus; Endoplasmic reticulum membrane
|
|||||
| Function |
Transcription factor that may act during endoplasmic reticulum stress by activating unfolded protein response target genes. Activated in response to cAMP stimulation. In vitro, binds to the cAMP response element (CRE) and box-B element. Activates transcription through box-B element. Activates transcription through CRE. May function synergistically with ATF6. In acute inflammatory response, may activate expression of acute phase response (APR) genes. May be involved in growth suppression. Regulates FGF21 transcription. Plays a crucial role in the regulation of triglyceride metabolism and is required for the maintenance of normal plasma triglyceride concentrations.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Lysosomal membrane ascorbate-dependent ferrireductase CYB561A3 (CYB561A3) | . | Q8NBI2 | |||
Transporter and channel
Transcription factor
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Probable G-protein coupled receptor 25 (GPR25) | G-protein coupled receptor 1 family | O00155 | |||
Other
References

