Details of the Target

General Information of Target

Target ID LDTP07291
Target Name WD repeat-containing protein 25 (WDR25)
Gene Name WDR25
Gene ID 79446
Synonyms
C14orf67; WD repeat-containing protein 25
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTARTLSLMASLVAYDDSDSEAETEHAGSFNATGQQKDTSGVARPPGQDFASGTLDVPKA
GAQPTKHGSCEDPGGYRLPLAQLGRSDWGSCPSQRLQWPGKEPQVTFPIKEPSCSSLWTS
HVPASHMPLAAARFKQVKLSRNFPKSSFHAQSESETVGKNGSSFQKKKCEDCVVPYTPRR
LRQRQALSTETGKGKDVEPQGPPAGRAPAPLYVGPGVSEFIQPYLNSHYKETTVPRKVLF
HLRGHRGPVNTIQWCPVLSKSHMLLSTSMDKTFKVWNAVDSGHCLQTYSLHTEAVRAARW
APCGRRILSGGFDFALHLTDLETGTQLFSGRSDFRITTLKFHPKDHNIFLCGGFSSEMKA
WDIRTGKVMRSYKATIQQTLDILFLREGSEFLSSTDASTRDSADRTIIAWDFRTSAKISN
QIFHERFTCPSLALHPREPVFLAQTNGNYLALFSTVWPYRMSRRRRYEGHKVEGYSVGCE
CSPGGDLLVTGSADGRVLMYSFRTASRACTLQGHTQACVGTTYHPVLPSVLATCSWGGDM
KIWH
Target Bioclass
Other
Uniprot ID
Q64LD2
Ensemble ID
ENST00000335290.10
HGNC ID
HGNC:21064

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A431 SNV: p.I109M .
NCIH1793 SNV: p.W118Ter .
NCIH446 SNV: p.R335Ter .
RKO SNV: p.R405H .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C255(2.39)  LDD3409  [1]
ATP probe
 Probe Info  		K340(0.00); K344(0.00)  LDD0199  [2]
IA-alkyne
 Probe Info  		N.A.  LDD0165  [3]
IPM
 Probe Info  		N.A.  LDD0005  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0020  ARS-1620 HCC44 C169(1.15); C172(1.15)  LDD2171  [5]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C429(3.61); C303(1.05)  LDD1702  [6]
 LDCM0022  KB02 AN3-CA C255(2.04)  LDD2264  [1]
 LDCM0023  KB03 AN3-CA C255(2.43)  LDD2681  [1]
 LDCM0024  KB05 RL95-2 C255(2.39)  LDD3409  [1]
 LDCM0021  THZ1 HCT 116 C169(1.15); C172(1.15)  LDD2173  [5]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
PR domain zinc finger protein 14 (PRDM14) Class V-like SAM-binding methyltransferase superfamily Q9GZV8
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-4 complex accessory subunit Tepsin (TEPSIN) . Q96N21
Other
Click To Hide/Show 19 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
A-kinase anchor protein 8-like (AKAP8L) AKAP95 family Q9ULX6
Cornifelin (CNFN) Cornifelin family Q9BYD5
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Segment polarity protein dishevelled homolog DVL-3 (DVL3) DSH family Q92997
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin-associated protein 12-3 (KRTAP12-3) KRTAP type 12 family P60328
Keratin-associated protein 3-1 (KRTAP3-1) KRTAP type 3 family Q9BYR8
Protein LDOC1 (LDOC1) LDOC1 family O95751
Notch homolog 2 N-terminal-like protein A (NOTCH2NLA) NOTCH family Q7Z3S9
Notch homolog 2 N-terminal-like protein C (NOTCH2NLC) NOTCH family P0DPK4
Proteasome activator complex subunit 3 (PSME3) PA28 family P61289
Keratin-associated protein 15-1 (KRTAP15-1) PMG family Q3LI76
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
Prefoldin subunit 5 (PFDN5) Prefoldin subunit alpha family Q99471
Four and a half LIM domains protein 3 (FHL3) . Q13643
Heat shock factor 2-binding protein (HSF2BP) . O75031

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
4 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
5 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
6 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761