Details of the Target
General Information of Target
| Target ID | LDTP07276 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative caspase recruitment domain-containing protein 17P (CARD17P) | |||||
| Gene Name | CARD17P | |||||
| Synonyms |
CARD17; INCA; Putative caspase recruitment domain-containing protein 17P; Caspase-1 inhibitor INCA; Inhibitory caspase recruitment domain protein |
|||||
| 3D Structure | ||||||
| Sequence |
MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDS
VIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, do not induce NF-kappa-B activation.
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C45(1.28) | LDD2412 | [1] | |
Competitor(s) Related to This Target