Details of the Target

General Information of Target

Target ID LDTP07246
Target Name KH domain-containing, RNA-binding, signal transduction-associated protein 2 (KHDRBS2)
Gene Name KHDRBS2
Gene ID 202559
Synonyms
SLM1; KH domain-containing, RNA-binding, signal transduction-associated protein 2; Sam68-like mammalian protein 1; SLM-1; hSLM-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKL
SERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSG
EAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNG
SEDSGRGRGIRGRGIRIAPTAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVAR
GVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVP
EYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY
Target Bioclass
Other
Family
KHDRBS family
Subcellular location
Nucleus
Function
RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Binds both poly(A) and poly(U) homopolymers. Phosphorylation by PTK6 inhibits its RNA-binding ability. Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. Can regulate alternative splicing of NRXN1 in the laminin G-like domain 6 containing the evolutionary conserved neurexin alternative spliced segment 4 (AS4) involved in neurexin selective targeting to postsynaptic partners. Regulates cell-type specific alternative splicing of NRXN1 at AS4 and acts synergystically with SAM68 in exon skipping. In contrast acts antagonistically with SAM68 in NRXN3 exon skipping at AS4. Its phosphorylation by FYN inhibits its ability to regulate splice site selection. May function as an adapter protein for Src kinases during mitosis.
Uniprot ID
Q5VWX1
Ensemble ID
ENST00000281156.5
HGNC ID
HGNC:18114

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
HHS-475
 Probe Info  		Y6(0.85)  LDD0264  [1]
Acrolein
 Probe Info  		N.A.  LDD0217  [2]
HHS-465
 Probe Info  		K112(0.00); K69(0.00); K73(0.00); Y346(0.00)  LDD2240  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [2]
 LDCM0116  HHS-0101 DM93 Y6(0.85)  LDD0264  [1]
 LDCM0117  HHS-0201 DM93 Y6(1.05)  LDD0265  [1]
 LDCM0118  HHS-0301 DM93 Y6(1.02)  LDD0266  [1]
 LDCM0119  HHS-0401 DM93 Y6(0.99)  LDD0267  [1]
 LDCM0120  HHS-0701 DM93 Y6(1.05)  LDD0268  [1]
 LDCM0107  IAA HeLa N.A.  LDD0221  [2]
 LDCM0109  NEM HeLa N.A.  LDD0224  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Paraplegin (SPG7) AAA ATPase family; Peptidase M41 family Q9UQ90
Replication factor C subunit 3 (RFC3) Activator 1 small subunits family P40938
Protein-tyrosine kinase 6 (PTK6) Tyr protein kinase family Q13882
Non-receptor tyrosine-protein kinase TYK2 (TYK2) Tyr protein kinase family P29597
Sulfotransferase 1A3 (SULT1A3) Sulfotransferase 1 family P0DMM9
Apoptosis-enhancing nuclease (AEN) . Q8WTP8
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Metal transporter CNNM3 (CNNM3) ACDP family Q8NE01
Cation channel sperm-associated protein 1 (CATSPER1) Cation channel sperm-associated (TC 1.A.1.19) family Q8NEC5
Syntenin-1 (SDCBP) . O00560
Transcription factor
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 497 (ZNF497) Krueppel C2H2-type zinc-finger protein family Q6ZNH5
Zinc finger protein 837 (ZNF837) Krueppel C2H2-type zinc-finger protein family Q96EG3
Forkhead box protein D4-like 3 (FOXD4L3) . Q6VB84
Hematopoietically-expressed homeobox protein HHEX (HHEX) . Q03014
Metastasis-associated protein MTA1 (MTA1) . Q13330
Zinc finger protein 581 (ZNF581) . Q9P0T4
Other
Click To Hide/Show 19 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Dedicator of cytokinesis protein 2 (DOCK2) DOCK family Q92608
Hemoglobin subunit zeta (HBZ) Globin family P02008
KH domain-containing, RNA-binding, signal transduction-associated protein 3 (KHDRBS3) KHDRBS family O75525
Neural proliferation differentiation and control protein 1 (NPDC1) NPDC1/cab-1 family Q9NQX5
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
SOSS complex subunit B2 (NABP1) SOSS-B family Q96AH0
Bone morphogenetic protein 7 (BMP7) TGF-beta family P18075
Bromo adjacent homology domain-containing 1 protein (BAHD1) . Q8TBE0
Chromatin target of PRMT1 protein (CHTOP) . Q9Y3Y2
Cold-inducible RNA-binding protein (CIRBP) . Q14011
Heterogeneous nuclear ribonucleoprotein R (HNRNPR) . O43390
Lamin tail domain-containing protein 2 (LMNTD2) . Q8IXW0
Proline-rich protein 3 (PRR3) . P79522
RNA-binding motif protein, X chromosome (RBMX) . P38159
RNA-binding protein 10 (RBM10) . P98175
RNA-binding protein 14 (RBM14) . Q96PK6
RNA-binding protein 3 (RBM3) . P98179
TYMS opposite strand protein (TYMSOS) . Q8TAI1
YTH domain-containing protein 1 (YTHDC1) . Q96MU7

References

1 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
3 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010