Details of the Target
General Information of Target
| Target ID | LDTP07220 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein-cysteine N-palmitoyltransferase HHAT (HHAT) | |||||
| Gene Name | HHAT | |||||
| Gene ID | 55733 | |||||
| Synonyms |
MART2; SKI1; Protein-cysteine N-palmitoyltransferase HHAT; EC 2.3.1.-; Hedgehog acyltransferase; Melanoma antigen recognized by T-cells 2; MART-2; Skinny hedgehog protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEW
SFWMEWGKQWLVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLH TTISFCVAQFRSQLLTWLCSLLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYY TSFSLELCWQQLPAASTSYSFPWMLAYVFYYPVLHNGPILSFSEFIKQMQQQEHDSLKAS LCVLALGLGRLLCWWWLAELMAHLMYMHAIYSSIPLLETVSCWTLGGLALAQVLFFYVKY LVLFGVPALLMRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHNFLIRYVYIPVGGSQHG LLGTLFSTAMTFAFVSYWHGGYDYLWCWAALNWLGVTVENGVRRLVETPCIQDSLARYFS PQARRRFHAALASCSTSMLILSNLVFLGGNEVGKTYWNRIFIQGWPWVTLSVLGFLYCYS HVGIAWAQTYATD |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Membrane-bound acyltransferase family, HHAT subfamily
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Palmitoyl acyltransferase that catalyzes N-terminal palmitoylation of SHH; which is required for SHH signaling. It also catalyzes N-terminal palmitoylation of DHH. Promotes the transfer of palmitoyl-CoA from the cytoplasmic to the luminal side of the endoplasmic reticulum membrane, where SHH palmitoylation occurs. It is an essential factor for proper embryonic development and testicular organogenesis.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C410(0.94) | LDD1511 | [1] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0281 | AC21 | HEK-293T | C410(0.99) | LDD1520 | [1] |
| LDCM0289 | AC29 | HEK-293T | C410(0.99) | LDD1528 | [1] |
| LDCM0298 | AC37 | HEK-293T | C410(0.90) | LDD1537 | [1] |
| LDCM0307 | AC45 | HEK-293T | C410(0.95) | LDD1546 | [1] |
| LDCM0312 | AC5 | HEK-293T | C410(0.85) | LDD1551 | [1] |
| LDCM0316 | AC53 | HEK-293T | C410(0.88) | LDD1555 | [1] |
| LDCM0325 | AC61 | HEK-293T | C410(0.89) | LDD1564 | [1] |
| LDCM0248 | AKOS034007472 | HEK-293T | C410(0.94) | LDD1511 | [1] |
| LDCM0409 | CL21 | HEK-293T | C410(1.63) | LDD1613 | [1] |
| LDCM0422 | CL33 | HEK-293T | C410(1.60) | LDD1626 | [1] |
| LDCM0435 | CL45 | HEK-293T | C410(1.47) | LDD1639 | [1] |
| LDCM0448 | CL57 | HEK-293T | C410(1.49) | LDD1651 | [1] |
| LDCM0461 | CL69 | HEK-293T | C410(1.53) | LDD1664 | [1] |
| LDCM0475 | CL81 | HEK-293T | C410(1.29) | LDD1678 | [1] |
| LDCM0484 | CL9 | HEK-293T | C410(1.31) | LDD1687 | [1] |
| LDCM0488 | CL93 | HEK-293T | C410(1.27) | LDD1691 | [1] |
The Interaction Atlas With This Target
References


