General Information of Target

Target ID LDTP07038
Target Name WD repeat domain phosphoinositide-interacting protein 1 (WIPI1)
Gene Name WIPI1
Gene ID 55062
Synonyms
WIPI49; WD repeat domain phosphoinositide-interacting protein 1; WIPI-1; Atg18 protein homolog; WD40 repeat protein interacting with phosphoinositides of 49 kDa; WIPI 49 kDa
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDV
YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEES
IYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVC
TIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQ
DRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLL
GSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGP
VCLDDENEFPPIILCRGNQKGKTKQS
Target Bioclass
Other
Family
WD repeat PROPPIN family
Subcellular location
Golgi apparatus, trans-Golgi network
Function
Component of the autophagy machinery that controls the major intracellular degradation process by which cytoplasmic materials are packaged into autophagosomes and delivered to lysosomes for degradation. Plays an important role in starvation- and calcium-mediated autophagy, as well as in mitophagy. Functions downstream of the ULK1 and PI3-kinases that produce phosphatidylinositol 3-phosphate (PtdIns3P) on membranes of the endoplasmic reticulum once activated. Binds phosphatidylinositol 3-phosphate (PtdIns3P), and maybe other phosphoinositides including PtdIns3,5P2 and PtdIns5P, and is recruited to phagophore assembly sites at the endoplasmic reticulum membranes. There, it assists WIPI2 in the recruitment of ATG12-ATG5-ATG16L1, a complex that directly controls the elongation of the nascent autophagosomal membrane. Together with WDR45/WIPI4, promotes ATG2 (ATG2A or ATG2B)-mediated lipid transfer by enhancing ATG2-association with phosphatidylinositol 3-monophosphate (PI3P)-containing membranes. Involved in xenophagy of Staphylococcus aureus. Invading S.aureus cells become entrapped in autophagosome-like WIPI1 positive vesicles targeted for lysosomal degradation. Also plays a distinct role in controlling the transcription of melanogenic enzymes and melanosome maturation, a process that is distinct from starvation-induced autophagy. May also regulate the trafficking of proteins involved in the mannose-6-phosphate receptor (MPR) recycling pathway.
Uniprot ID
Q5MNZ9
Ensemble ID
ENST00000262139.10
HGNC ID
HGNC:25471

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
MOLT4 SNV: p.A382T .
TE4 SNV: p.E206K .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info 
K221(5.00)  LDD0277  [1]
DBIA
 Probe Info 
C318(3.39)  LDD3310  [2]
NAIA_5
 Probe Info 
N.A.  LDD2223  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0281  AC21 HEK-293T C95(0.97)  LDD1520  [4]
 LDCM0289  AC29 HEK-293T C95(0.97)  LDD1528  [4]
 LDCM0298  AC37 HEK-293T C95(1.10)  LDD1537  [4]
 LDCM0307  AC45 HEK-293T C95(1.04)  LDD1546  [4]
 LDCM0312  AC5 HEK-293T C95(1.05)  LDD1551  [4]
 LDCM0316  AC53 HEK-293T C95(1.09)  LDD1555  [4]
 LDCM0325  AC61 HEK-293T C95(1.09)  LDD1564  [4]
 LDCM0248  AKOS034007472 HEK-293T C95(1.04)  LDD1511  [4]
 LDCM0020  ARS-1620 HCC44 C422(0.82); C435(0.82)  LDD2171  [5]
 LDCM0409  CL21 HEK-293T C95(0.97)  LDD1613  [4]
 LDCM0422  CL33 HEK-293T C95(0.98)  LDD1626  [4]
 LDCM0435  CL45 HEK-293T C95(1.05)  LDD1639  [4]
 LDCM0448  CL57 HEK-293T C95(1.19)  LDD1651  [4]
 LDCM0461  CL69 HEK-293T C95(1.05)  LDD1664  [4]
 LDCM0475  CL81 HEK-293T C95(1.07)  LDD1678  [4]
 LDCM0484  CL9 HEK-293T C95(1.06)  LDD1687  [4]
 LDCM0488  CL93 HEK-293T C95(1.07)  LDD1691  [4]
 LDCM0022  KB02 A101D C95(1.79); C318(2.24)  LDD2250  [2]
 LDCM0023  KB03 A101D C95(2.11)  LDD2667  [2]
 LDCM0024  KB05 COLO792 C318(3.39)  LDD3310  [2]
 LDCM0021  THZ1 HCT 116 C422(0.82); C435(0.82)  LDD2173  [5]

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
4 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
5 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.