Details of the Target
General Information of Target
| Target ID | LDTP07014 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc-regulated GTPase metalloprotein activator 1C (ZNG1C) | |||||
| Gene Name | ZNG1C | |||||
| Gene ID | 445571 | |||||
| Synonyms |
CBWD3; Zinc-regulated GTPase metalloprotein activator 1C; EC 3.6.5.-; Cobalamin synthase W domain-containing protein 3; COBW domain-containing protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MLPAVGSVDEEEDPAEEDCPELVPIETTQSEEEEKSGLGAKIPVTIITGYLGAGKTTLLN
YILTEQHSKRVAVILNESGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLRAI ENLMQKKGKFDDILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTE EKPDGLINEATRQVALADIILINKTDLVPEEDVKKLRTTIRSINGLGQILETQRSRVDLS NVLDLHAFDSLSGISLQKKLQHVPGTQPHLDQSIVTITFEVPGNAKEEHLNMFIQNLLWE KNVRNKDNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDDTERTNRLVLI GRNLDKDILKQLFIATVTETEKQWTTHFKEDQVCT |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
SIMIBI class G3E GTPase family, ZNG1 subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Zinc chaperone that directly transfers zinc cofactor to target metalloproteins, thereby activating them. Catalyzes zinc insertion into the active site of methionine aminopeptidase METAP1, which function to cleave the initiator methionine from polypeptides during or after protein translation. Mechanistically, the N-terminal psi-PxLVp motif binds to the C6H2-type zinc finger of inactive form of METAP1. After formation of the docked complex, zinc is transferred from the CXCC motif in the GTPase domain of ZNG1C to the zinc binding site in the peptidase domain of METAP1 in a process requiring GTP hydrolysis. GTP/GDP exchange is required for release of active METAP1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0176 | [1] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0005 | [2] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Caspase-6 (CASP6) | Peptidase C14A family | P55212 | |||
| GTP-binding nuclear protein Ran (RAN) | Ran family | P62826 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
| Peroxisome assembly protein 26 (PEX26) | Peroxin-26 family | Q7Z412 | |||
| Huntingtin-interacting protein 1 (HIP1) | SLA2 family | O00291 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Zinc finger MYND domain-containing protein 19 (ZMYND19) | . | Q96E35 | |||
References


