Details of the Target
General Information of Target
| Target ID | LDTP07011 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cytochrome c oxidase assembly factor 6 homolog (COA6) | |||||
| Gene Name | COA6 | |||||
| Gene ID | 388753 | |||||
| Synonyms |
C1orf31; Cytochrome c oxidase assembly factor 6 homolog |
|||||
| 3D Structure | ||||||
| Sequence |
MGPGGPLLSPSRGFLLCKTGWHSNRLLGDCGPHTPVSTALSFIAVGMAAPSMKERQVCWG
ARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSE TTAKS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Cytochrome c oxidase subunit 6B family
|
|||||
| Subcellular location |
Mitochondrion intermembrane space
|
|||||
| Function |
Involved in the maturation of the mitochondrial respiratory chain complex IV subunit MT-CO2/COX2. Thereby, may regulate early steps of complex IV assembly. Mitochondrial respiratory chain complex IV or cytochrome c oxidase is the component of the respiratory chain that catalyzes the transfer of electrons from intermembrane space cytochrome c to molecular oxygen in the matrix and as a consequence contributes to the proton gradient involved in mitochondrial ATP synthesis. May also be required for efficient formation of respiratory supercomplexes comprised of complexes III and IV.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AZ-9 Probe Info |
![]() |
E112(10.00) | LDD2209 | [1] | |
|
Acrolein Probe Info |
![]() |
C90(0.00); C58(0.00) | LDD0222 | [2] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [3] | |
|
IA-alkyne Probe Info |
![]() |
C68(0.00); C90(0.00) | LDD0162 | [4] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [3] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0035 | [5] | |
|
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [2] | |
|
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Probable E3 ubiquitin-protein ligase DTX2 (DTX2) | Deltex family | Q86UW9 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Tetratricopeptide repeat protein 19, mitochondrial (TTC19) | TTC19 family | Q6DKK2 | |||
| Calcium-binding protein 2 (CABP2) | . | Q9NPB3 | |||
References








