Details of the Target

General Information of Target

Target ID LDTP07007
Target Name EF-hand domain-containing family member C2 (EFHC2)
Gene Name EFHC2
Gene ID 80258
Synonyms
EF-hand domain-containing family member C2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MALPLLPGNSFNRNVGKEKFHKSQHWGFCNNVMMLVSDEKPGIGGEPLLGQKIKPKCSIY
PKGDGSDVPSWVAFDKQVLSFDAYLEEEVLDKSQTNYRIRYYKIYFYPEDDTIQVNEPEV
KNSGLLQGTSIRRHRITLPPPDEDQFYTVYHFNVGTEVVFYGRTFKIYDCDAFTRNFLRK
IGVKVNPPVQCPEDPYMKIRREVVEHVEPLRPYESLDTLKQFLQYHGKILCFFCLWDDSV
SMFGDRRELILHYFLCDDTIEIKELLPHSSGRDALKMFLRRSKLPKNCPPRVYQPGQITD
RAVLNSYGDFIKNQADGYLFDRYKLGKVDQEFYKDSDLSLGVTINVWGRKVLLYDCDEFT
KSYYKSKYGIENFTSVSCKPPSPPPKIERKFPPYNGFGSEEDSLRNCIDLKPTPHRRNFK
KFMEKDSYGSKSNILRFFAKLVTDKCVDLDRMFVISYYLGDDTISVFEPIERNSGIAGGM
FLKRSRVKKPGQEVFKSELSEYIKAEELYIGVTVNVNGYLFRLLNADEYTLNYMEQNTDK
YPFSNLKLALQKLKQEEGKSRELKQVFKAADSKHTNMVDYNTFRDILMSLTVGNLAEQEF
VTIARHYRVPEGTCSDMDFLIALAHEKFKKNMFENFDTFIYSCVYEDREKKNVLPTKDIK
RLCKSSRLPLSDDLLESLLSRFEDSEKQIDYKSFFSALNWRKNPVPELQPASYLKERCED
VWLGMPSPIPAKYIDYWTFLKDAFGLEEE
Target Bioclass
Other
Subcellular location
Cytoplasm, cytoskeleton, cilium axoneme
Function Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating.
Uniprot ID
Q5JST6
Ensemble ID
ENST00000420999.2
HGNC ID
HGNC:26233

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCC44 SNV: p.Y428C .
JHH7 SNV: p.M33V .
JURKAT SNV: p.C407F .
MCC13 SNV: p.E157K .
MELJUSO SNV: p.S215F .
MOLT4 Insertion: p.L678_L679insP
SNV: p.L678F		 .
NCIH1944 SNV: p.T738N .
NCIH2286 SNV: p.L255S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
N1
 Probe Info  		N.A.  LDD0245  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 27 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Maspardin (SPG21) AB hydrolase superfamily Q9NZD8
DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C) Archaeal Rpo3/eukaryotic RPB3 RNA polymerase subunit family O15160
Glutamine--tRNA ligase (QARS1) Class-I aminoacyl-tRNA synthetase family P47897
Probable ATP-dependent RNA helicase DDX6 (DDX6) DEAD box helicase family P26196
Glycerate kinase (GLYCTK) Glycerate kinase type-2 family Q8IVS8
Glycogen [starch] synthase, muscle (GYS1) Glycosyltransferase 3 family P13807
Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A (INPP5J) Inositol 1,4,5-trisphosphate 5-phosphatase type II family Q15735
NADPH-dependent diflavin oxidoreductase 1 (NDOR1) NADPH-dependent diflavin oxidoreductase NDOR1 family; Flavodoxin family; Flavoprotein pyridine nucleotide cytochrome reductase family Q9UHB4
Nucleoside diphosphate kinase homolog 7 (NME7) NDK family Q9Y5B8
L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT) AcpS family Q9NRN7
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
Phenazine biosynthesis-like domain-containing protein (PBLD) PhzF family P30039
Testis-specific serine/threonine-protein kinase 3 (TSSK3) CAMK Ser/Thr protein kinase family Q96PN8
Mitogen-activated protein kinase 9 (MAPK9) CMGC Ser/Thr protein kinase family P45984
Serine/threonine-protein kinase 16 (STK16) Ser/Thr protein kinase family O75716
Protein-tyrosine kinase 6 (PTK6) Tyr protein kinase family Q13882
Tyrosine-protein kinase TXK (TXK) Tyr protein kinase family P42681
Exosome complex component RRP46 (EXOSC5) RNase PH family Q9NQT4
GTP-binding protein GEM (GEM) RGK family P55040
E3 ubiquitin-protein ligase TRIM50 (TRIM50) TRIM/RBCC family Q86XT4
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
E3 ubiquitin-protein ligase MYLIP (MYLIP) . Q8WY64
LON peptidase N-terminal domain and RING finger protein 1 (LONRF1) . Q17RB8
Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 (PLOD3) . O60568
Prolyl hydroxylase EGLN3 (EGLN3) . Q9H6Z9
Rho-related BTB domain-containing protein 3 (RHOBTB3) . O94955
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Voltage-dependent L-type calcium channel subunit beta-4 (CACNB4) Calcium channel beta subunit family O00305
Chloride intracellular channel protein 3 (CLIC3) Chloride channel CLIC family O95833
TBC1 domain family member 1 (TBC1D1) . Q86TI0
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger and BTB domain-containing protein 16 (ZBTB16) Krueppel C2H2-type zinc-finger protein family Q05516
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
PHD finger protein 1 (PHF1) Polycomblike family O43189
Other
Click To Hide/Show 36 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Atos homolog protein B (ATOSB) ATOS family Q7L5A3
Coatomer subunit epsilon (COPE) COPE family O14579
Copine-2 (CPNE2) Copine family Q96FN4
Dynein regulatory complex subunit 7 (DRC7) DRC7 family Q8IY82
Enhancer of mRNA-decapping protein 3 (EDC3) EDC3 family Q96F86
Protein FAM221B (FAM221B) FAM221 family A6H8Z2
Growth factor receptor-bound protein 2 (GRB2) GRB2/sem-5/DRK family P62993
Lamin-B2 (LMNB2) Intermediate filament family Q03252
Janus kinase and microtubule-interacting protein 2 (JAKMIP2) JAKMIP family Q96AA8
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
Mitochondria-eating protein (SPATA18) MIEAP family Q8TC71
Mitotic interactor and substrate of PLK1 (MISP) MISP family Q8IVT2
G-patch domain and KOW motifs-containing protein (GPKOW) MOS2 family Q92917
Neurochondrin (NCDN) Neurochondrin family Q9UBB6
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
DNA repair protein RAD51 homolog 4 (RAD51D) RecA family O75771
Splicing factor U2AF 35 kDa subunit (U2AF1) Splicing factor SR family Q01081
Tektin-4 (TEKT4) Tektin family Q8WW24
Armadillo repeat-containing protein 7 (ARMC7) . Q9H6L4
Calcium-binding protein 2 (CABP2) . Q9NPB3
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Coiled-coil domain-containing protein 13 (CCDC13) . Q8IYE1
Cytoplasmic protein NCK2 (NCK2) . O43639
EF-hand domain-containing protein 1 (EFHC1) . Q5JVL4
Emerin (EMD) . P50402
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
Golgin subfamily A member 1 (GOLGA1) . Q92805
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Lethal(3)malignant brain tumor-like protein 2 (L3MBTL2) . Q969R5
PRKCA-binding protein (PICK1) . Q9NRD5
Rho guanine nucleotide exchange factor 5 (ARHGEF5) . Q12774
TBC1 domain family member 22B (TBC1D22B) . Q9NU19
U11/U12 small nuclear ribonucleoprotein 25 kDa protein (SNRNP25) . Q9BV90
ZZ-type zinc finger-containing protein 3 (ZZZ3) . Q8IYH5

References

1 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.