Details of the Target
General Information of Target
| Target ID | LDTP06963 | |||||
|---|---|---|---|---|---|---|
| Target Name | PDZ domain-containing protein 11 (PDZD11) | |||||
| Gene Name | PDZD11 | |||||
| Gene ID | 51248 | |||||
| Synonyms |
AIPP1; PDZK11; PISP; PDZ domain-containing protein 11; ATPase-interacting PDZ protein; Plasma membrane calcium ATPase-interacting single-PDZ protein; PMCA-interacting single-PDZ protein |
|||||
| 3D Structure | ||||||
| Sequence |
MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGF
NIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREI SMRVRFFPYNYHRQKERTVH |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted; Cytoplasm
|
|||||
| Function | Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10-binding protein TSPAN33. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K115(10.00) | LDD0277 | [1] | |

