Details of the Target
General Information of Target
| Target ID | LDTP06923 | |||||
|---|---|---|---|---|---|---|
| Target Name | Plasma membrane ascorbate-dependent reductase CYBRD1 (CYBRD1) | |||||
| Gene Name | CYBRD1 | |||||
| Gene ID | 79901 | |||||
| Synonyms |
DCYTB; FRRS3; Plasma membrane ascorbate-dependent reductase CYBRD1; EC 7.2.1.3; Cytochrome b reductase 1; Duodenal cytochrome b; Ferric-chelate reductase 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVF
IQGIAIIVYRLPWTWKCSKLLMKSIHAGLNAVAAILAIISVVAVFENHNVNNIANMYSLH SWVGLIAVICYLLQLLSGFSVFLLPWAPLSLRAFLMPIHVYSGIVIFGTVIATALMGLTE KLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWKRPKEPNSTILHPNGG TEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Plasma membrane reductase that uses cytoplasmic ascorbate as an electron donor to reduce extracellular Fe(3+) into Fe(2+). Probably functions in dietary iron absorption at the brush border of duodenal enterocytes by producing Fe(2+), the divalent form of iron that can be transported into enterocytes. It is also able to reduce extracellular monodehydro-L-ascorbate and may be involved in extracellular ascorbate regeneration by erythrocytes in blood. May also act as a ferrireductase in airway epithelial cells (Probable). May also function as a cupric transmembrane reductase.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K228(2.24) | LDD0277 | [1] | |

