Details of the Target
General Information of Target
Target ID | LDTP06912 | |||||
---|---|---|---|---|---|---|
Target Name | Coiled-coil domain-containing protein 92 (CCDC92) | |||||
Gene Name | CCDC92 | |||||
Gene ID | 80212 | |||||
Synonyms |
Coiled-coil domain-containing protein 92; Limkain beta-2 |
|||||
3D Structure | ||||||
Sequence |
MTSPHFSSYDEGPLDVSMAATNLENQLHSAQKNLLFLQREHASTLKGLHSEIRRLQQHCT
DLTYELTVKSSEQTGDGTSKSSELKKRCEELEAQLKVKENENAELLKELEQKNAMITVLE NTIKEREKKYLEELKAKSHKLTLLSSELEQRASTIAYLTSQLHAAKKKLMSSSGTSDASP SGSPVLASYKPAPPKDKLPETPRRRMKKSLSAPLHPEFEEVYRFGAESRKLLLREPVDAM PDPTPFLLARESAEVHLIKERPLVIPPIASDRSGEQHSPAREKPHKAHVGVAHRIHHATP PQAQPEVKTLAVDQVNGGKVVRKHSGTDRTV |
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole
|
|||||
Function |
Interferon-stimulated protein that plays a role in innate immunity. Strongly inhibits ebolavirus transcription and replication. Forms a complex with viral RNA-bound nucleocapsid NP and thereby prevents the transport of NP to the cell surface.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C88(1.46) | LDD3367 | [2] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0215 | AC10 | HEK-293T | C59(0.99) | LDD1508 | [3] |
LDCM0277 | AC18 | HEK-293T | C59(0.90) | LDD1516 | [3] |
LDCM0279 | AC2 | HEK-293T | C59(1.04) | LDD1518 | [3] |
LDCM0286 | AC26 | HEK-293T | C59(1.03) | LDD1525 | [3] |
LDCM0295 | AC34 | HEK-293T | C59(0.91) | LDD1534 | [3] |
LDCM0304 | AC42 | HEK-293T | C59(0.97) | LDD1543 | [3] |
LDCM0313 | AC50 | HEK-293T | C59(0.93) | LDD1552 | [3] |
LDCM0321 | AC58 | HEK-293T | C59(0.99) | LDD1560 | [3] |
LDCM0405 | CL18 | HEK-293T | C59(0.98) | LDD1609 | [3] |
LDCM0419 | CL30 | HEK-293T | C59(0.92) | LDD1623 | [3] |
LDCM0432 | CL42 | HEK-293T | C59(1.00) | LDD1636 | [3] |
LDCM0445 | CL54 | HEK-293T | C59(0.93) | LDD1648 | [3] |
LDCM0451 | CL6 | HEK-293T | C59(0.88) | LDD1654 | [3] |
LDCM0458 | CL66 | HEK-293T | C59(0.93) | LDD1661 | [3] |
LDCM0471 | CL78 | HEK-293T | C59(0.92) | LDD1674 | [3] |
LDCM0485 | CL90 | HEK-293T | C59(0.87) | LDD1688 | [3] |
LDCM0022 | KB02 | 769-P | C88(1.27) | LDD2246 | [2] |
LDCM0023 | KB03 | 769-P | C88(1.52) | LDD2663 | [2] |
LDCM0024 | KB05 | NUGC-3 | C88(1.46) | LDD3367 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Zinc finger protein RFP (TRIM27) | TRIM/RBCC family | P14373 | |||
Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2) | . | Q8N7C3 |
Other
References