Details of the Target

General Information of Target

Target ID LDTP06899
Target Name Pleckstrin homology domain-containing family O member 1 (PLEKHO1)
Gene Name PLEKHO1
Gene ID 51177
Synonyms
CKIP1; OC120; Pleckstrin homology domain-containing family O member 1; PH domain-containing family O member 1; C-Jun-binding protein; JBP; Casein kinase 2-interacting protein 1; CK2-interacting protein 1; CKIP-1; Osteoclast maturation-associated gene 120 protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEV
KDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEK
ESWINALNSAITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTST
SDGMLTLDLIQEEDPSPEEPTSCAESFRVDLDKSVAQLAGSRRRADSDRIQPSADRASSL
SRPWEKTDKGATYTPQAPKKLTPTEKGRCASLEEILSQRDAASARTLQLRAEEPPTPALP
NPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQLLLETERLLG
EASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTPHSQYRKSLM
Target Bioclass
Other
Subcellular location
Cell membrane
Function
Plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). May function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). Appears to target ATM to the plasma membrane. Appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. Also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.
Uniprot ID
Q53GL0
Ensemble ID
ENST00000369124.5
HGNC ID
HGNC:24310

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AN3CA Insertion: p.T247NfsTer46 .
KMCH1 SNV: p.R169M .
KNS42 SNV: p.R44C .
KYSE510 SNV: p.S271F .
MEWO SNV: p.P302S .
RL952 SNV: p.A174V .
RPMI8226 SNV: p.I66V .
SW756 SNV: p.E63K .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		C269(9.79)  LDD1705  [1]
IPM
 Probe Info  		N.A.  LDD2156  [2]
NPM
 Probe Info  		N.A.  LDD0016  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0024  KB05 T cell C269(9.79)  LDD1705  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
26S proteasome regulatory subunit 8 (PSMC5) AAA ATPase family P62195
Cytochrome P450 4F2 (CYP4F2) Cytochrome P450 family P78329
Ubiquitin carboxyl-terminal hydrolase 7 (USP7) Peptidase C19 family Q93009
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (BNIP2) . Q12982
E3 ubiquitin-protein ligase SMURF1 (SMURF1) . Q9HCE7
Transporter and channel
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Monocyte to macrophage differentiation factor (MMD) ADIPOR family Q15546
Vesicle-associated membrane protein 3 (VAMP3) Synaptobrevin family Q15836
Tetraspanin-33 (TSPAN33) Tetraspanin (TM4SF) family Q86UF1
Transmembrane protein 218 (TMEM218) TMEM218 family A2RU14
Translocating chain-associated membrane protein 1-like 1 (TRAM1L1) TRAM family Q8N609
Translocator protein 2 (TSPO2) TspO/BZRP family Q5TGU0
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Tumor necrosis factor (TNF) Tumor necrosis factor family P01375
Other
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Centrosomal protein of 19 kDa (CEP19) CEP19 family Q96LK0
Low-density lipoprotein receptor-related protein 10 (LRP10) LDLR family Q7Z4F1
Beta-soluble NSF attachment protein (NAPB) SNAP family Q9H115
Zinc finger protein-like 1 (ZFPL1) ZFPL1 family O95159
Thrombospondin type-1 domain-containing protein 7B (THSD7B) . Q9C0I4
TRAF3-interacting JNK-activating modulator (TRAF3IP3) . Q9Y228

References

1 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
2 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
3 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764