Details of the Target
General Information of Target
| Target ID | LDTP06878 | |||||
|---|---|---|---|---|---|---|
| Target Name | Keratin-associated protein 13-2 (KRTAP13-2) | |||||
| Gene Name | KRTAP13-2 | |||||
| Gene ID | 337959 | |||||
| Synonyms |
KAP13.2; Keratin-associated protein 13-2 |
|||||
| 3D Structure | ||||||
| Sequence |
MSYNCCSGNFSSRSCGDYLRYPASSRGFSYPSNLVYSTDLCSPSTCQLGSSLYRGCQEIC
WEPTSCQTSYVESSPCQTSCYRPRTSLLCSPCKTTYSGSLGFGSSSCRSLGYGSRSCYSV GCGSSGVRSLGYGSCGFPSLGYGSGFCRPTYLASRSCQSPCYRPAYGSTFCRSTC |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
PMG family
|
|||||
| Function |
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C83(2.49) | LDD3332 | [1] | |
Competitor(s) Related to This Target