Details of the Target
General Information of Target
Target ID | LDTP06799 | |||||
---|---|---|---|---|---|---|
Target Name | 2-acylglycerol O-acyltransferase 2 (MOGAT2) | |||||
Gene Name | MOGAT2 | |||||
Gene ID | 80168 | |||||
Synonyms |
DC5; DGAT2L5; 2-acylglycerol O-acyltransferase 2; EC 2.3.1.20; EC 2.3.1.22; Acyl-CoA:monoacylglycerol acyltransferase 2; MGAT2; hMGAT2; Diacylglycerol O-acyltransferase candidate 5; hDC5; Diacylglycerol acyltransferase 2-like protein 5; Monoacylglycerol O-acyltransferase 2
|
|||||
3D Structure | ||||||
Sequence |
MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLD
RDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFAN LCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNL LGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSG SWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEE VNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC |
|||||
Target Type |
Clinical trial
|
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Diacylglycerol acyltransferase family
|
|||||
Subcellular location |
Endoplasmic reticulum membrane
|
|||||
Function |
Involved in glycerolipid synthesis and lipid metabolism. Catalyzes the formation of diacylglycerol, the precursor of triacylglycerol, by transferring the acyl chain of a fatty acyl-CoA to a monoacylglycerol. Plays a central role in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes. Has a preference toward monoacylglycerols containing unsaturated fatty acids in an order of C18:3 > C18:2 > C18:1 > C18:0 at sn-2. Able to use 1-monoalkylglycerol (1-MAkG, 1-O-alkylglycerol) as an acyl acceptor for the synthesis of monoalkyl-monoacylglycerol (MAMAG, 1-O-alkyl-3-acylglycerol or 1-O-alkyl-2-acylglycerol) and subsequently, with lower efficiency, may add another acyl chain producing monoalkyl-diacylglycerol (MADAG, 1-O-alkyl-2,3-diacylglycerol). Possesses weak but significant activity with diacylglycerol as substrate, producing triacylglycerol (triacyl-sn-glycerol).
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C313(3.90) | LDD2269 | [1] |
Competitor(s) Related to This Target