Details of the Target
General Information of Target
| Target ID | LDTP06783 | |||||
|---|---|---|---|---|---|---|
| Target Name | tRNA pseudouridine synthase Pus10 (PUS10) | |||||
| Gene Name | PUS10 | |||||
| Gene ID | 150962 | |||||
| Synonyms |
CCDC139; DOBI; tRNA pseudouridine synthase Pus10; Hup10; EC 5.4.99.25; Coiled-coil domain-containing protein 139; tRNA pseudouridine 55 synthase; Psi55 synthase; tRNA pseudouridylate synthase; tRNA-uridine isomerase
|
|||||
| 3D Structure | ||||||
| Sequence |
MFPLTEENKHVAQLLLNTGTCPRCIFRFCGVDFHAPYKLPYKELLNELQKFLETEKDELI
LEVMNPPPKKIRLQELEDSIDNLSQNGEGRISVSHVGSTASKNSNLNVCNVCLGILQEFC EKDFIKKVCQKVEASGFEFTSLVFSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRDDIV QLKEAYKWITHPLFSEELGVPIDGKSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNK QSVFTRMAVMKALNKIKEEDFLKQFPCPPNSPKAVCAVLEIECAHGAVFVAGRYNKYSRN LPQTPWIIDGERKLESSVEELISDHLLAVFKAESFNFSSSGREDVDVRTLGNGRPFAIEL VNPHRVHFTSQEIKELQQKINNSSNKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT NKAIQKKDIEFLNDIKDLKIDQKTPLRVLHRRPLAVRARVIHFMETQYVDEHHFRLHLKT QAGTYIKEFVHGDFGRTKPNIGSLMNVTADILELDVESVDVDWPPALDD |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Pseudouridine synthase Pus10 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Protein with different functions depending on its subcellular location: involved in miRNA processing in the nucleus and acts as a tRNA pseudouridylate synthase in the cytoplasm. In the cytoplasm, acts as a pseudouridylate synthase by catalyzing synthesis of pseudouridine(54) and pseudouridine(55) from uracil-54 and uracil-55, respectively, in the psi GC loop of a subset of tRNAs. tRNA pseudouridylate synthase activity is enhanced by the presence of 1-methyladenosine at position 53-61 of tRNAs. Does not show tRNA pseudouridylate synthase activity in the nucleus. In the nucleus, promotes primary microRNAs (pri-miRNAs) processing independently of its RNA pseudouridylate synthase activity. Binds pri-miRNAs. Modulator of TRAIL/TNFSF10-induced cell death via activation of procaspase-8 and BID cleavage. Required for the progression of the apoptotic signal through intrinsic mitochondrial cell death.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
C29(0.00); C21(0.00) | LDD0241 | [1] | |
|
DBIA Probe Info |
![]() |
C29(2.94) | LDD3310 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0367 | CL1 | HEK-293T | C29(0.96) | LDD1571 | [3] |
| LDCM0370 | CL101 | HEK-293T | C29(1.35) | LDD1574 | [3] |
| LDCM0371 | CL102 | HEK-293T | C29(0.88) | LDD1575 | [3] |
| LDCM0374 | CL105 | HEK-293T | C29(1.23) | LDD1578 | [3] |
| LDCM0375 | CL106 | HEK-293T | C29(1.24) | LDD1579 | [3] |
| LDCM0378 | CL109 | HEK-293T | C29(0.93) | LDD1582 | [3] |
| LDCM0380 | CL110 | HEK-293T | C29(0.78) | LDD1584 | [3] |
| LDCM0383 | CL113 | HEK-293T | C29(1.23) | LDD1587 | [3] |
| LDCM0384 | CL114 | HEK-293T | C29(0.81) | LDD1588 | [3] |
| LDCM0387 | CL117 | HEK-293T | C29(1.20) | LDD1591 | [3] |
| LDCM0388 | CL118 | HEK-293T | C29(1.04) | LDD1592 | [3] |
| LDCM0392 | CL121 | HEK-293T | C29(0.99) | LDD1596 | [3] |
| LDCM0393 | CL122 | HEK-293T | C29(0.90) | LDD1597 | [3] |
| LDCM0396 | CL125 | HEK-293T | C29(1.09) | LDD1600 | [3] |
| LDCM0397 | CL126 | HEK-293T | C29(0.78) | LDD1601 | [3] |
| LDCM0400 | CL13 | HEK-293T | C29(1.02) | LDD1604 | [3] |
| LDCM0401 | CL14 | HEK-293T | C29(0.98) | LDD1605 | [3] |
| LDCM0407 | CL2 | HEK-293T | C29(0.93) | LDD1611 | [3] |
| LDCM0413 | CL25 | HEK-293T | C29(1.09) | LDD1617 | [3] |
| LDCM0414 | CL26 | HEK-293T | C29(0.95) | LDD1618 | [3] |
| LDCM0426 | CL37 | HEK-293T | C29(1.19) | LDD1630 | [3] |
| LDCM0439 | CL49 | HEK-293T | C29(1.63) | LDD1643 | [3] |
| LDCM0441 | CL50 | HEK-293T | C29(0.93) | LDD1645 | [3] |
| LDCM0453 | CL61 | HEK-293T | C29(1.37) | LDD1656 | [3] |
| LDCM0454 | CL62 | HEK-293T | C29(1.01) | LDD1657 | [3] |
| LDCM0466 | CL73 | HEK-293T | C29(1.13) | LDD1669 | [3] |
| LDCM0467 | CL74 | HEK-293T | C29(1.16) | LDD1670 | [3] |
| LDCM0479 | CL85 | HEK-293T | C29(1.17) | LDD1682 | [3] |
| LDCM0480 | CL86 | HEK-293T | C29(0.77) | LDD1683 | [3] |
| LDCM0492 | CL97 | HEK-293T | C29(1.33) | LDD1695 | [3] |
| LDCM0493 | CL98 | HEK-293T | C29(0.91) | LDD1696 | [3] |
| LDCM0427 | Fragment51 | HEK-293T | C29(0.82) | LDD1631 | [3] |
| LDCM0022 | KB02 | 697 | C29(2.02) | LDD2245 | [2] |
| LDCM0023 | KB03 | 697 | C29(3.22) | LDD2662 | [2] |
| LDCM0024 | KB05 | COLO792 | C29(2.94) | LDD3310 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Lactoylglutathione lyase (GLO1) | Glyoxalase I family | Q04760 | |||
| Ubiquitin carboxyl-terminal hydrolase 25 (USP25) | Peptidase C19 family | Q9UHP3 | |||
Other
References


