Details of the Target
General Information of Target
| Target ID | LDTP06671 | |||||
|---|---|---|---|---|---|---|
| Target Name | Endothelial cell-specific chemotaxis regulator (ECSCR) | |||||
| Gene Name | ECSCR | |||||
| Gene ID | 641700 | |||||
| Synonyms |
ECSM2; Endothelial cell-specific chemotaxis regulator; Apoptosis regulator through modulating IAP expression; ARIA; Endothelial cell-specific molecule 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MGTAGAMQLCWVILGFLLFRGHNSQPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEA
NRPSHLSSTGTPGAGVPSSGRDGGTSRDTFQTVPPNSTTMSLSMREDATILPSPTSETVL TVAAFGVISFIVILVVVVIILVGVVSLRFKCRKSKESEDPQKPGSSGLSESCSTANGEKD SITLISMKNINMNNGKQSLSAEKVL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
ECSCR family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Regulates endothelial chemotaxis and tube formation. Has a role in angiogenesis and apoptosis via modulation of the actin cytoskeleton and facilitation of proteasomal degradation of the apoptosis inhibitors BIRC3/IAP1 and BIRC2/IAP2.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C172(1.47) | LDD3478 | [1] | |
Competitor(s) Related to This Target

