Details of the Target
General Information of Target
| Target ID | LDTP06662 | |||||
|---|---|---|---|---|---|---|
| Target Name | Rho GTPase-activating protein 44 (ARHGAP44) | |||||
| Gene Name | ARHGAP44 | |||||
| Gene ID | 9912 | |||||
| Synonyms |
KIAA0672; RICH2; Rho GTPase-activating protein 44; NPC-A-10; Rho-type GTPase-activating protein RICH2; RhoGAP interacting with CIP4 homologs protein 2; RICH-2 |
|||||
| 3D Structure | ||||||
| Sequence |
MKKQFNRMRQLANQTVGRAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGA
EADKRSKKLPLTTLAQCLMEGSAILGDDTLLGKMLKLCGETEDKLAQELIHFELQVERDV IEPLFLLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSSLQPAGAKADALR EEMEEAANRVEICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLTLLQAVLPQI KAQQEAWVEKPSFGKPLEEHLTISGREIAFPIEACVTMLLECGMQEEGLFRVAPSASKLK KLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYDEWIQASNVQEQDKKL QALWNACEKLPKANHNNIRYLIKFLSKLSEYQDVNKMTPSNMAIVLGPNLLWPQAEGNIT EMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNITGNYGSPVHVNHNANYSSMPSPDMDPA DRRQPEQARRPLSVATDNMMLEFYKKDGLRKIQSMGVRVMDTNWVARRGSSAGRKVSCAP PSMQPPAPPAELAAPLPSPLPEQPLDSPAAPALSPSGLGLQPGPERTSTTKSKELSPGSA QKGSPGSSQGTACAGTQPGAQPGAQPGASPSPSQPPADQSPHTLRKVSKKLAPIPPKVPF GQPGAMADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFT STLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIP SIHIELGSTLRLSPLEHMRRHSVTDKRDSEEESESTAL |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cell projection, dendritic spine
|
|||||
| Function |
GTPase-activating protein (GAP) that stimulates the GTPase activity of Rho-type GTPases. Thereby, controls Rho-type GTPases cycling between their active GTP-bound and inactive GDP-bound states. Acts as a GAP at least for CDC42 and RAC1. In neurons, is involved in dendritic spine formation and synaptic plasticity in a specific RAC1-GAP activity. Limits the initiation of exploratory dendritic filopodia. Recruited to actin-patches that seed filopodia, binds specifically to plasma membrane sections that are deformed inward by acto-myosin mediated contractile forces. Acts through GAP activity on RAC1 to reduce actin polymerization necessary for filopodia formation. In association with SHANK3, promotes GRIA1 exocytosis from recycling endosomes and spine morphological changes associated to long-term potentiation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C367(1.14) | LDD1509 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [2] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [3] | |
|
AOyne Probe Info |
![]() |
13.30 | LDD0443 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0226 | AC11 | HEK-293T | C367(1.14) | LDD1509 | [1] |
| LDCM0278 | AC19 | HEK-293T | C367(1.08) | LDD1517 | [1] |
| LDCM0287 | AC27 | HEK-293T | C367(1.17) | LDD1526 | [1] |
| LDCM0290 | AC3 | HEK-293T | C367(1.13) | LDD1529 | [1] |
| LDCM0296 | AC35 | HEK-293T | C367(1.13) | LDD1535 | [1] |
| LDCM0305 | AC43 | HEK-293T | C367(1.16) | LDD1544 | [1] |
| LDCM0314 | AC51 | HEK-293T | C367(1.09) | LDD1553 | [1] |
| LDCM0322 | AC59 | HEK-293T | C367(1.20) | LDD1561 | [1] |
| LDCM0372 | CL103 | HEK-293T | C367(1.18) | LDD1576 | [1] |
| LDCM0376 | CL107 | HEK-293T | C367(1.19) | LDD1580 | [1] |
| LDCM0381 | CL111 | HEK-293T | C367(0.90) | LDD1585 | [1] |
| LDCM0385 | CL115 | HEK-293T | C367(1.21) | LDD1589 | [1] |
| LDCM0389 | CL119 | HEK-293T | C367(1.28) | LDD1593 | [1] |
| LDCM0394 | CL123 | HEK-293T | C367(1.11) | LDD1598 | [1] |
| LDCM0398 | CL127 | HEK-293T | C367(0.94) | LDD1602 | [1] |
| LDCM0402 | CL15 | HEK-293T | C367(1.59) | LDD1606 | [1] |
| LDCM0406 | CL19 | HEK-293T | C367(1.09) | LDD1610 | [1] |
| LDCM0415 | CL27 | HEK-293T | C367(1.17) | LDD1619 | [1] |
| LDCM0418 | CL3 | HEK-293T | C367(1.03) | LDD1622 | [1] |
| LDCM0420 | CL31 | HEK-293T | C367(1.10) | LDD1624 | [1] |
| LDCM0428 | CL39 | HEK-293T | C367(1.20) | LDD1632 | [1] |
| LDCM0433 | CL43 | HEK-293T | C367(1.18) | LDD1637 | [1] |
| LDCM0446 | CL55 | HEK-293T | C367(1.21) | LDD1649 | [1] |
| LDCM0455 | CL63 | HEK-293T | C367(1.16) | LDD1658 | [1] |
| LDCM0459 | CL67 | HEK-293T | C367(1.24) | LDD1662 | [1] |
| LDCM0462 | CL7 | HEK-293T | C367(1.10) | LDD1665 | [1] |
| LDCM0472 | CL79 | HEK-293T | C367(1.23) | LDD1675 | [1] |
| LDCM0481 | CL87 | HEK-293T | C367(0.98) | LDD1684 | [1] |
| LDCM0486 | CL91 | HEK-293T | C367(1.22) | LDD1689 | [1] |
| LDCM0494 | CL99 | HEK-293T | C367(0.97) | LDD1697 | [1] |
| LDCM0495 | E2913 | HEK-293T | C367(1.10) | LDD1698 | [1] |
| LDCM0468 | Fragment33 | HEK-293T | C367(1.20) | LDD1671 | [1] |
The Interaction Atlas With This Target
References




