Details of the Target
General Information of Target
| Target ID | LDTP06652 | |||||
|---|---|---|---|---|---|---|
| Target Name | V-type proton ATPase subunit F (ATP6V1F) | |||||
| Gene Name | ATP6V1F | |||||
| Gene ID | 9296 | |||||
| Synonyms |
ATP6S14; VATF; V-type proton ATPase subunit F; V-ATPase subunit F; V-ATPase 14 kDa subunit; Vacuolar proton pump subunit F |
|||||
| 3D Structure | ||||||
| Sequence |
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDD
IGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
V-ATPase F subunit family
|
|||||
| Subcellular location |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane
|
|||||
| Function |
Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
5E-2FA Probe Info |
 |
N.A. | LDD2235 | [1] | |
|
ATP probe Probe Info |
 |
N.A. | LDD0199 | [2] | |
|
m-APA Probe Info |
 |
N.A. | LDD2231 | [1] | |
The Interaction Atlas With This Target
References