Details of the Target

General Information of Target

Target ID LDTP06630
Target Name Carbonic anhydrase 9 (CA9)
Gene Name CA9
Gene ID 768
Synonyms
G250; MN; Carbonic anhydrase 9; EC 4.2.1.1; Carbonate dehydratase IX; Carbonic anhydrase IX; CA-IX; CAIX; Membrane antigen MN; P54/58N; Renal cell carcinoma-associated antigen G250; RCC-associated antigen G250; pMW1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPVHPQRLPRMQEDSPLGGGSSGEDDPL
GEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPG
DPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPL
ELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHT
VEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIA
EEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLS
DTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF
GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGA
Target Type
Clinical trial
Target Bioclass
Enzyme
Family
Alpha-carbonic anhydrase family
Subcellular location
Nucleus
Function Catalyzes the interconversion between carbon dioxide and water and the dissociated ions of carbonic acid (i.e. bicarbonate and hydrogen ions).
TTD ID
T64567
Uniprot ID
Q16790
DrugMap ID
TT2LVK8
Ensemble ID
ENST00000378357.9
HGNC ID
HGNC:1383
ChEMBL ID
CHEMBL3594

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
OPA-S-S-alkyne
 Probe Info  		K133(8.23)  LDD3494  [1]
DBIA
 Probe Info  		C156(1.55)  LDD3310  [2]
Acrolein
 Probe Info  		N.A.  LDD0225  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 769-P C156(1.14)  LDD2246  [2]
 LDCM0023  KB03 42-MG-BA C156(2.16)  LDD2661  [2]
 LDCM0024  KB05 COLO792 C156(1.55)  LDD3310  [2]
 LDCM0109  NEM HeLa N.A.  LDD0225  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Glutaredoxin-3 (GLRX3) . O76003
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cysteine and glycine-rich protein 1 (CSRP1) . P21291

The Drug(s) Related To This Target

Approved
Click To Hide/Show 5 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Benzthiazide Small molecular drug DB00562
Cyclothiazide Small molecular drug DB00606
Hydroflumethiazide Small molecular drug DB00774
Zonisamide Small molecular drug DB00909
Sodium Carbonate . DB09460
Phase 3
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Curcumin Small molecular drug D07SDQ
Phenol Small molecular drug D0L6HN
Paraben . D0A8JP
Phase 2
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Girentuximab I-124 Monoclonal antibody D0BH7Z
Coumate Small molecular drug D0Y6OA
Indisulam Small molecular drug D04IIU
Phase 1
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
90y-cg250 Antibody D05CVC
Bay 79-4620 Antibody D03PQW
Sulfamide Small molecular drug D0V0UK
Investigative
Click To Hide/Show 171 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
(2-bromophenyl)Difluoromethanesulfonamide Small molecular drug D04JIN
(4-bromophenyl)Difluoromethanesulfonamide Small molecular drug D0IU3X
(4-sulfamoylphenylethylthioureido)Fluorescein Small molecular drug D0BM2T
1,4-dihydro-1-methyl-4-oxo-3-pyridinesulfonamide Small molecular drug D05RAB
1,4-phenylene Disulfamate Small molecular drug D0C6ED
1-(3,4-dichlorophenyl)-3-hydroxyurea Small molecular drug D09UQM
1-benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide Small molecular drug D04SNH
1-cyclohexylamido-5-sulfonamidoindane Small molecular drug D0G9NE
1-pentafluorophenylamido-5-sulfonamidoindane Small molecular drug D0O4KL
1-valproylamido-5-sulfonamidoindane Small molecular drug D0KZ2D
2,2,2-trifluoro-n-(4-sulfamoyl-phenyl)-acetamide Small molecular drug D0RK7J
2,2-dimethyl-n-(4-sulfamoyl-phenyl)-propionamide Small molecular drug D03DAM
2,4-disulfamyltrifluoromethylaniline Small molecular drug D0M3PO
2-(4-chlorobenzyloxyamino)-n-hydroxyacetamide Small molecular drug D05BMD
2-(4-chlorobenzyloxyamino)-n-hydroxyhexanamide Small molecular drug D06NDR
2-(4-chlorobenzyloxyamino)-n-hydroxypropanamide Small molecular drug D0G0OP
2-(Benzyloxyamino)-n-hydroxy-3-methylpentanamide Small molecular drug D07VXX
2-(Benzyloxyamino)-n-hydroxyacetamide Small molecular drug D00TRF
2-(Benzyloxyamino)-n-hydroxyhexanamide Small molecular drug D0Y1XM
2-(N''-acetyl-hydrazino)-benzenesulfonamide Small molecular drug D02KDH
2-acetamido-5-sulfonamidoindane Small molecular drug D00FGB
2-amino-benzenesulfonamide Small molecular drug D0OI1H
2-butylamido-5-sulfonamidoindane Small molecular drug D0SF3B
2-cyclohexylamido-5-sulfonamidoindane Small molecular drug D0HN0R
2-ethylamido-5-sulfonamidoindane Small molecular drug D08AOA
2-hydrazinocarbonyl-benzenesulfonamide Small molecular drug D06KTD
2-hydrazinylbenzenesulfonamide Small molecular drug D0G0FJ
2-mercapto-n-(4-sulfamoyl-phenyl)-benzamide Small molecular drug D01EEM
2-morpholin-4-yl-n-(4-sulfamoyl-phenyl)-acetamide Small molecular drug D0D0BO
2-nonylamido-5-sulfonamidoindane Small molecular drug D07PNA
2-oxo-2h-chromene-3-carboxylic Acid Small molecular drug D0H3NS
2-oxo-2h-thiochromene-3-carboxylic Acid Small molecular drug D0D6UR
2-pentafluorophenylamido-5-sulfonamidoindane Small molecular drug D0J3SP
2-propylamido-5-sulfonamidoindane Small molecular drug D0O8WV
2-sulfamoyl-benzoic Acid Methyl Ester Small molecular drug D07CQI
2-valproylamido-5-sulfonamidoindane Small molecular drug D07LYW
3-((4-aminophenyl)Diazenyl)Benzenesulfonamide Small molecular drug D0H4CF
3-((4-hydroxyphenyl)Diazenyl)Benzenesulfonamide Small molecular drug D0C7WG
3-(3-phenyl-ureido)-benzenesulfonamide Small molecular drug D06ZMH
3-(4'-hydroxyphenyl)Diazenylbenzenesulfonamide Small molecular drug D0BD0K
3-amino-benzenesulfonamide Small molecular drug D0J2AE
3-bromophenyl-difluoromethanesulfonamide Small molecular drug D01JTI
3-chloro-4-hydrazino-benzenesulfonamide Small molecular drug D01UDU
3-fluoro-4-hydrazino-benzenesulfonamide Small molecular drug D01YHK
3-mercapto-n-(4-sulfamoyl-phenyl)-propionamide Small molecular drug D0DY9U
4,4'-thiodipyridine-3-sulfonamide Small molecular drug D03KRB
4-((4-hydroxyphenyl)Diazenyl)Benzenesulfonamide Small molecular drug D04HRS
4-(2-aminoethyl)Benzenesulfonamide Small molecular drug D04NSN
4-(2-aminopyrimidin-4-ylamino)Benzenesulfonamide Small molecular drug D0TY8X
4-(2-methyl-8-quinolinoxy)-3-pyridinesulfonamide Small molecular drug D05ETN
4-(2-propynylthio)Pyridine-3-sulfonamide Small molecular drug D02BMV
4-(4'-n-methylphenyl)Diazenylbenzenesulfonamide Small molecular drug D00RDE
4-(4-cyanophenoxy)-3-pyridinesulfonamide Small molecular drug D05EBZ
4-(4-fluorophenoxy)-3-pyridinesulfonamide Small molecular drug D08JCC
4-(5-methyl-2-pirazolino)-3-pyridinesulfonamide Small molecular drug D0R4KQ
4-(Allylamino)-3-pyridinesulfonamide Small molecular drug D09TKG
4-(Carbamolymethylthio)Pyridine-3-sulfonamide Small molecular drug D0V5OW
4-(Cyanomethylthio)Pyridine-3-sulfonamide Small molecular drug D01OTW
4-(Hydroxymethyl)Benzenesulfonamide Small molecular drug D05XZM
4-(Methylhydrazino)-3-pyridinesulfonamide Small molecular drug D0Q5VB
4-(N-oxide-2-pyridylthio)Pyridine-3-sulfonamide Small molecular drug D02NQK
4-(Quinolinoxy)-3-pyridinesulfonamide Small molecular drug D05JAJ
4-amino-3-chloro-benzenesulfonamide Small molecular drug D0YU8J
4-amino-6-chlorobenzene-1,3-disulfonamide Small molecular drug D0Z1HY
4-amino-n-(4-sulfamoylbenzyl)Benzenesulfonamide Small molecular drug D0X6IE
4-azidobenzenesulfonamide Small molecular drug D0Z6TM
4-benzenesulfonylamino-benzenesulfonamide Small molecular drug D0YD9F
4-benzythiopyridine-3-sulfonamide Small molecular drug D06IOI
4-ethoxy-3-pyridinesulfonamide Small molecular drug D04VSP
4-ethynyl Benzene Sulfonamide Small molecular drug D0LJ5P
4-fluoro-n-(4-sulfamoylbenzyl)Benzenesulfonamide Small molecular drug D0X9LJ
4-hydrazino-3-pyridinesulfonamide Small molecular drug D0UM1I
4-hydrazino-benzenesulfonamide Small molecular drug D0NN3Q
4-hydrazinocarbonyl-benzenesulfonamide Small molecular drug D0Q0EK
4-methanesulfonylamino-benzenesulfonamide Small molecular drug D00NUK
4-methoxy-3-pyridinesulfonamide Small molecular drug D00IKQ
4-methylphenyl-difluoromethanesulfonamide Small molecular drug D06GPL
4-methylthiopyridine-3-sulfonamide Small molecular drug D0J7GU
4-nitrophenyl-difluoromethanesulfonamide Small molecular drug D0I5YQ
4-[2-(3-phenyl-ureido)-ethyl]-benzenesulfonamide Small molecular drug D09LUD
5-amino-[1,3,4]Thiadiazole-2-thiol Small molecular drug D0X1MY
6-(Aminomethyl)-2h-chromen-2-one Small molecular drug D0N1AW
6-(Hydroxymethyl)-2h-chromen-2-one Small molecular drug D0L5TZ
6-acetyl-7-ethoxy-2h-chromen-2-one Small molecular drug D01CXM
6-acetyl-7-hydroxy-2h-chromen-2-one Small molecular drug D02MAK
6-acetyl-7-methoxy-2h-chromen-2-one Small molecular drug D05VUA
6-acetyl-7-propoxy-2h-chromen-2-one Small molecular drug D0J7KJ
6-methoxy-2-oxo-2h-chromene-3-carboxylic Acid Small molecular drug D00XJA
6-methyl-2-oxo-2h-chromene-3-carboxylic Acid Small molecular drug D0G3BI
7-(Benzyloxy)-2h-chromen-2-one Small molecular drug D00RNZ
7-butoxy-2h-chromen-2-one Small molecular drug D0LU4S
7-ethoxy-8-propionyl-2h-chromen-2-one Small molecular drug D01FOK
7-hydroxy-6-propionyl-2h-chromen-2-one Small molecular drug D0EY2F
7-hydroxy-8-propionyl-2h-chromen-2-one Small molecular drug D0EH0S
7-hydroxycoumarin Small molecular drug D02JEZ
7-methoxy-2-oxo-2h-chromene-4-carboxylic Acid Small molecular drug D0RB0D
7-methoxy-8-propionyl-2h-chromen-2-one Small molecular drug D0T9BB
7-phenethoxy-2h-chromen-2-one Small molecular drug D05QUG
7-propoxy-2h-chromen-2-one Small molecular drug D0OT5L
8-acetyl-7-(Benzyloxy)-2h-chromen-2-one Small molecular drug D0O6ZD
8-acetyl-7-butoxy-2h-chromen-2-one Small molecular drug D08JNO
8-acetyl-7-ethoxy-2h-chromen-2-one Small molecular drug D06WZG
8-acetyl-7-hydroxy-2h-chromen-2-one Small molecular drug D0K1FG
8-acetyl-7-methoxy-2h-chromen-2-one Small molecular drug D0F7KC
8-acetyl-7-propoxy-2h-chromen-2-one Small molecular drug D03LHJ
8-methoxy-2-oxo-2h-chromene-3-carboxylic Acid Small molecular drug D06DYP
8-propionyl-7-propoxy-2h-chromen-2-one Small molecular drug D0V0FY
Acetylsulfanilamide Small molecular drug D04POB
Aminobenzolamide Derivative Small molecular drug D05QEK
Azide Small molecular drug D09JHA
Benzolamide Small molecular drug D0E8CC
Bicarbonate Small molecular drug D09JAR
Carzenide Small molecular drug D09PWX
Catechin Small molecular drug D0V7AA
Cl-5343 Small molecular drug D0VD7H
Coumarin Small molecular drug D03ZMQ
Decane-1,10-diyl Disulfamate Small molecular drug D00YEF
Decyl Sulfamate Small molecular drug D09WSJ
Ellagic Acid Small molecular drug D0A1CM
Ellagic Acid Small molecular drug DB08846
Ethoxycoumarin Small molecular drug D05VSK
Ethyl 7-methoxy-2-oxo-2h-chromene-3-carboxylate Small molecular drug D07TAJ
Gallicacid Small molecular drug D0Y3TZ
Herniarin Small molecular drug D0U4BB
Hexane-1,6-diamine Small molecular drug D09JPC
Hydrosulfide Small molecular drug D0T6ZX
Mmi270 Small molecular drug D0A4TC
N-(4-cyanophenyl)Sulfamide Small molecular drug D0M4EV
N-(4-sulfamoyl-phenyl)-benzamide Small molecular drug D0KB6T
N-(4-sulfamoyl-phenyl)-butyramide Small molecular drug D0K3LN
N-(4-sulfamoyl-phenyl)-isobutyramide Small molecular drug D0T2YZ
N-(4-sulfamoyl-phenyl)-propionamide Small molecular drug D0N8LR
N-(4-sulfamoylphenylethyl)-4-sulfamoylbenzamide Small molecular drug D07YSQ
N-(5-mercapto-[1,3,4]Thiadiazol-2-yl)-acetamide Small molecular drug D0J1PZ
N-(Pentafluorophenyl)Sulfamide Small molecular drug D0PA5L
N-hydroxysulfamide Small molecular drug D09CXX
N-propynyl Amidebenzenesulphonide Small molecular drug D01XFH
N1-(2-aminoethyl)Ethane-1,2-diamine Small molecular drug D09WVV
N1-(Naphthalen-1-yl)Ethane-1,2-diamine Small molecular drug D0X5HL
Nsc-654077 Small molecular drug D0B4IN
Octane-1,8-diyl Disulfamate Small molecular drug D0D4OV
Octyl Sulfamate Small molecular drug D05TLB
P-coumaric Acid Small molecular drug D0AU0M
P-toluenesulfonamide Small molecular drug D0ZC3W
Pentane-1,5-diamine Small molecular drug D02QGI
Pentanoic Acid (4-sulfamoyl-phenyl)-amide Small molecular drug D0Q0XO
Phenyldifluoromethanesulfonamide Small molecular drug D0UN0E
Phenylmethanesulfonamide Small molecular drug D07SIA
Phenylsulfamate Small molecular drug D0L4FM
Prop-2-ynyl 4-sulfamoylbenzoate Small molecular drug D00IAE
Quinoline-8-sulfonamide Small molecular drug D0F7SO
Saccharin Small molecular drug D0A0YX
Sodium N-methylphenylaminomethanesulfonate Small molecular drug D0M9IQ
Sodium Phenylaminomethanesulfonate Small molecular drug D07UCQ
Sulfamic Acid 12-sulfamoyloxy-dodecyl Ester Small molecular drug D07ZXR
Sulfamic Acid 16-sulfamoyloxy-hexadecyl Ester Small molecular drug D07CBA
Sulfamic Acid 3-sulfamoyloxy-phenyl Ester Small molecular drug D07IHP
Sulfamic Acid 4-sulfamoyloxy-butyl Ester Small molecular drug D04BKU
Sulfamic Acid 4-sulfamoyloxymethyl-benzyl Ester Small molecular drug D0N5KX
Sulfamic Acid 6-sulfamoyloxy-hexyl Ester Small molecular drug D0X0PO
Sulfamic Acid 7-sulfamoyloxy-heptyl Ester Small molecular drug D05FNN
Syringic Acid Small molecular drug D0Q7DJ
1-acetamido-5-sulfonamidoindane . D00XIB
4-(2-hydroxy-ethyl)-benzenesulfonamide . D04VLI
4-amino-3-bromo-benzenesulfonamide . D0P6AM
4-amino-3-fluoro-benzenesulfonamide . D04CVC
4-amino-3-iodo-benzenesulfonamide . D01STY
6-hydroxy-benzothiazole-2-sulfonic Acid Amide . D0Q2LL
Dtp-348 . DB12741
Girentuximab . DB05304
Sulfamate . D03VDJ
Patented
Click To Hide/Show 6 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ferulic Acid Small molecular drug D03SLR
Pmid30074415-compound-12 Small molecular drug D0UK9U
Pmid30074415-compound-gs3 Small molecular drug D01YQE
Sulfonamide Derivative 12 Small molecular drug D08RPE
Sulfonamide-thiadiazole Derivative 1 Small molecular drug D0W9VU
Sulfonamide-thiadiazole Derivative 2 Small molecular drug D06LLY
Discontinued
Click To Hide/Show 2 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ca9-adc Antibody D01BUS
Spermine Small molecular drug D0LD9S

References

1 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.