Details of the Target
General Information of Target
| Target ID | LDTP06610 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H3.1t (H3-4) | |||||
| Gene Name | H3-4 | |||||
| Gene ID | 8290 | |||||
| Synonyms |
H3FT; HIST3H3; Histone H3.1t; H3/t; H3t; H3/g; Histone H3.4 |
|||||
| 3D Structure | ||||||
| Sequence |
MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTI MPKDIQLARRIRGERA |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H3 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
12.53 | LDD0402 | [1] | |
|
AZ-9 Probe Info |
![]() |
D78(0.98) | LDD2208 | [2] | |
|
Acrolein Probe Info |
![]() |
K123(0.00); K57(0.00) | LDD0221 | [3] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [4] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [4] | |
|
STPyne Probe Info |
![]() |
K37(0.00); K80(0.00); K57(0.00); K123(0.00) | LDD0009 | [5] | |
|
AOyne Probe Info |
![]() |
13.60 | LDD0443 | [6] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Other
References







