Details of the Target
General Information of Target
| Target ID | LDTP06579 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transcription factor NF-E2 45 kDa subunit (NFE2) |
|
||||
| Gene Name | NFE2 | |||||
| Gene ID | 4778 | |||||
| Synonyms |
Transcription factor NF-E2 45 kDa subunit; Leucine zipper protein NF-E2; Nuclear factor, erythroid-derived 2 45 kDa subunit; p45 NF-E2 |
|||||
| 3D Structure | ||||||
| Sequence |
MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPP
PPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPL QDPLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEY PYSLMPNSLAHSNYTLPAAETPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTD KIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAAQNCRKRKLETIVQLERELER LTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEYALQQAADGTI FLVPRGTKMEATD |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
BZIP family, CNC subfamily
|
|||||
| Subcellular location |
Nucleus, PML body
|
|||||
| Function |
Component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. Binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. Requires MAFK or other small MAF proteins for binding to the NF-E2 motif. May play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
C283(3.69) | LDD1701 | [1] | |
|
DBIA Probe Info |
 |
C283(0.42) | LDD2236 | [2] | |
Competitor(s) Related to This Target
References