Details of the Target
General Information of Target
| Target ID | LDTP06575 | |||||
|---|---|---|---|---|---|---|
| Target Name | Serotonin N-acetyltransferase (AANAT) | |||||
| Gene Name | AANAT | |||||
| Gene ID | 15 | |||||
| Synonyms |
SNAT; Serotonin N-acetyltransferase; Serotonin acetylase; EC 2.3.1.87; Aralkylamine N-acetyltransferase; AA-NAT |
|||||
| 3D Structure | ||||||
| Sequence |
MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVL
GVCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAH LHVLAVHRAFRQQGRGPILLWRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCA ITVGSLTFMELHCSLRGHPFLRRNSGC |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Acetyltransferase family, AANAT subfamily
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | Controls the night/day rhythm of melatonin production in the pineal gland. Catalyzes the N-acetylation of serotonin into N-acetylserotonin, the penultimate step in the synthesis of melatonin. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Methacrolein Probe Info |
 |
N.A. | LDD0218 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| MyoD family inhibitor (MDFI) | MDFI family | Q99750 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Class E basic helix-loop-helix protein 40 (BHLHE40) | . | O14503 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Keratin-associated protein 8-1 (KRTAP8-1) | KRTAP type 8 family | Q8IUC2 | |||