Details of the Target
General Information of Target
| Target ID | LDTP06559 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cocaine- and amphetamine-regulated transcript protein (CARTPT) | |||||
| Gene Name | CARTPT | |||||
| Gene ID | 9607 | |||||
| Synonyms |
CART; Cocaine- and amphetamine-regulated transcript protein [Cleaved into: CART(1-39; CART(42-89)] |
|||||
| 3D Structure | ||||||
| Sequence |
MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEV
LKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CART family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Satiety factor closely associated with the actions of leptin and neuropeptide Y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C82(1.92) | LDD2157 | [1] | |

