Details of the Target
General Information of Target
Target ID | LDTP06553 | |||||
---|---|---|---|---|---|---|
Target Name | Lymphocyte antigen 6E (LY6E) | |||||
Gene Name | LY6E | |||||
Gene ID | 4061 | |||||
Synonyms |
9804; RIGE; SCA2; TSA1; Lymphocyte antigen 6E; Ly-6E; Retinoic acid-induced gene E protein; RIG-E; Stem cell antigen 2; SCA-2; Thymic shared antigen 1; TSA-1 |
|||||
3D Structure | ||||||
Sequence |
MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNL
VTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLL SLLPALLRFGP |
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion. Also plays an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity.; (Microbial infection) Promotes entry, likely through an enhanced virus-cell fusion process, of various viruses including HIV-1, West Nile virus, dengue virus and Zika virus. In contrast, the paramyxovirus PIV5, which enters at the plasma membrane, does not require LY6E. Mechanistically, adopts a microtubule-like organization upon viral infection and enhances viral uncoating after endosomal escape.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Major facilitator superfamily domain-containing protein 6 (MFSD6) | MFSD6 family | Q6ZSS7 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Transmembrane protein 19 (TMEM19) | TMEM19 family | Q96HH6 | |||
Transmembrane protein 140 (TMEM140) | . | Q9NV12 |