Details of the Target
General Information of Target
| Target ID | LDTP06550 | |||||
|---|---|---|---|---|---|---|
| Target Name | Bcl-2-related protein A1 (BCL2A1) | |||||
| Gene Name | BCL2A1 | |||||
| Gene ID | 597 | |||||
| Synonyms |
BCL2L5; BFL1; GRS; HBPA1; Bcl-2-related protein A1; Bcl-2-like protein 5; Bcl2-L-5; Hemopoietic-specific early response protein; Protein BFL-1; Protein GRS |
|||||
| 3D Structure | ||||||
| Sequence |
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC |
|||||
| Target Type |
Patented-recorded
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Bcl-2 family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection. Can inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C55(2.19) | LDD3419 | [1] | |
Competitor(s) Related to This Target

