General Information of Target

Target ID LDTP06518
Target Name Nuclear factor erythroid 2-related factor 2 (NFE2L2)
Gene Name NFE2L2
Gene ID 4780
Synonyms
NRF2; Nuclear factor erythroid 2-related factor 2; NF-E2-related factor 2; NFE2-related factor 2; Nrf-2; HEBP1; Nuclear factor, erythroid derived 2, like 2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM
QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG
NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS
VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD
FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL
KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN
Target Type
Successful
Target Bioclass
Transcription factor
Family
BZIP family, CNC subfamily
Subcellular location
Cytoplasm, cytosol
Function
Transcription factor that plays a key role in the response to oxidative stress: binds to antioxidant response (ARE) elements present in the promoter region of many cytoprotective genes, such as phase 2 detoxifying enzymes, and promotes their expression, thereby neutralizing reactive electrophiles. In normal conditions, ubiquitinated and degraded in the cytoplasm by the BCR(KEAP1) complex. In response to oxidative stress, electrophile metabolites inhibit activity of the BCR(KEAP1) complex, promoting nuclear accumulation of NFE2L2/NRF2, heterodimerization with one of the small Maf proteins and binding to ARE elements of cytoprotective target genes. The NFE2L2/NRF2 pathway is also activated in response to selective autophagy: autophagy promotes interaction between KEAP1 and SQSTM1/p62 and subsequent inactivation of the BCR(KEAP1) complex, leading to NFE2L2/NRF2 nuclear accumulation and expression of cytoprotective genes. May also be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region. Also plays an important role in the regulation of the innate immune response and antiviral cytosolic DNA sensing. It is a critical regulator of the innate immune response and survival during sepsis by maintaining redox homeostasis and restraint of the dysregulation of pro-inflammatory signaling pathways like MyD88-dependent and -independent and TNF-alpha signaling. Suppresses macrophage inflammatory response by blocking pro-inflammatory cytokine transcription and the induction of IL6. Binds to the proximity of pro-inflammatory genes in macrophages and inhibits RNA Pol II recruitment. The inhibition is independent of the NRF2-binding motif and reactive oxygen species level. Represses antiviral cytosolic DNA sensing by suppressing the expression of the adapter protein STING1 and decreasing responsiveness to STING1 agonists while increasing susceptibility to infection with DNA viruses. Once activated, limits the release of pro-inflammatory cytokines in response to human coronavirus SARS-CoV-2 infection and to virus-derived ligands through a mechanism that involves inhibition of IRF3 dimerization. Also inhibits both SARS-CoV-2 replication, as well as the replication of several other pathogenic viruses including Herpes Simplex Virus-1 and-2, Vaccinia virus, and Zika virus through a type I interferon (IFN)-independent mechanism.
TTD ID
T88505
Uniprot ID
Q16236
DrugMap ID
TTA6ZN2
Ensemble ID
ENST00000397062.8
HGNC ID
HGNC:7782
ChEMBL ID
CHEMBL1075094

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CORL88 SNV: p.Q26P DBIA    Probe Info 
DOTC24510 SNV: p.E134K .
HEC1 SNV: p.G31R .
HEC1B SNV: p.G31R .
IGR1 SNV: p.Q73H .
JURKAT SNV: p.A355T .
JVM3 SNV: p.N314I .
KYSE180 SNV: p.D77V .
MCC13 SNV: p.P352L .
MFE319 Insertion: p.I473NfsTer3
SNV: p.P409S
.
SNU1 Insertion: p.I473NfsTer3 .
TE11 SNV: p.D29G .
TKKK SNV: p.H245Y DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C595(3.58)  LDD3323  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 A2058 C595(3.41)  LDD2253  [1]
 LDCM0023  KB03 A2058 C595(3.24)  LDD2670  [1]
 LDCM0024  KB05 SKMEL24 C595(3.58)  LDD3323  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA repair nuclease/redox regulator APEX1 (APEX1) DNA repair enzymes AP/ExoA family P27695
Lysine-specific histone demethylase 1A (KDM1A) Flavin monoamine oxidase family O60341
Caspase-7 (CASP7) Peptidase C14A family P55210
Dual specificity mitogen-activated protein kinase kinase 6 (MAP2K6) STE Ser/Thr protein kinase family P52564
Ceramide synthase 2 (CERS2) . Q96G23
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Importin subunit alpha-1 (KPNA2) Importin alpha family P52292
Importin subunit alpha-3 (KPNA4) Importin alpha family O00629
Transcription factor
Click To Hide/Show 31 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-dependent transcription factor ATF-4 (ATF4) BZIP family P18848
DNA damage-inducible transcript 3 protein (DDIT3) BZIP family P35638
cAMP-responsive element-binding protein-like 2 (CREBL2) BZIP family O60519
CREB/ATF bZIP transcription factor (CREBZF) BZIP family Q9NS37
Cyclic AMP-dependent transcription factor ATF-3 (ATF3) BZIP family P18847
CCAAT/enhancer-binding protein gamma (CEBPG) BZIP family P53567
Fos-related antigen 2 (FOSL2) BZIP family P15408
Protein FosB (FOSB) BZIP family P53539
Transcription factor Jun (JUN) BZIP family P05412
Transcription factor MafF (MAFF) BZIP family Q9ULX9
Transcription factor MafG (MAFG) BZIP family O15525
Transcription factor MafK (MAFK) BZIP family O60675
Thyrotroph embryonic factor (TEF) BZIP family Q10587
ETS domain-containing protein Elk-1 (ELK1) ETS family P19419
ETS translocation variant 1 (ETV1) ETS family P50549
ETS translocation variant 4 (ETV4) ETS family P43268
ETS-related transcription factor Elf-3 (ELF3) ETS family P78545
Protein C-ets-2 (ETS2) ETS family P15036
Transcription factor ETV6 (ETV6) ETS family P41212
Interferon regulatory factor 1 (IRF1) IRF family P10914
Retinoic acid receptor alpha (RARA) Nuclear hormone receptor family P10276
TATA-box-binding protein (TBP) TBP family P20226
Lymphoid enhancer-binding factor 1 (LEF1) TCF/LEF family Q9UJU2
Signal transducer and activator of transcription 3 (STAT3) Transcription factor STAT family P40763
Bromodomain and PHD finger-containing protein 3 (BRPF3) . Q9ULD4
Erythroid transcription factor (GATA1) . P15976
Nuclear body protein SP140 (SP140) . Q13342
Nuclear factor of activated T-cells 5 (NFAT5) . O94916
Proto-oncogene c-Rel (REL) . Q04864
Transcription factor p65 (RELA) . Q04206
Transcriptional adapter 2-alpha (TADA2A) . O75478
Other
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Actin-related protein 2/3 complex subunit 2 (ARPC2) ARPC2 family O15144
COP9 signalosome complex subunit 7a (COPS7A) CSN7/EIF3M family Q9UBW8
Eukaryotic translation initiation factor 3 subunit J (EIF3J) EIF-3 subunit J family O75822
Growth factor receptor-bound protein 2 (GRB2) GRB2/sem-5/DRK family P62993
Kelch-like ECH-associated protein 1 (KEAP1) KEAP1 family Q14145
Troponin T, slow skeletal muscle (TNNT1) Troponin T family P13805
Arfaptin-2 (ARFIP2) . P53365
Cilia- and flagella-associated protein 299 (CFAP299) . Q6V702
F-box/WD repeat-containing protein 11 (FBXW11) . Q9UKB1
F-box/WD repeat-containing protein 1A (BTRC) . Q9Y297
Polyamine-modulated factor 1 (PMF1) . Q6P1K2
WW domain-containing adapter protein with coiled-coil (WAC) . Q9BTA9

The Drug(s) Related To This Target

Phase 2
Click To Hide/Show 6 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ot551 Small interfering RNA DHG2O3
Cxa10 Small molecular drug DF1JO7
Omaveloxolone Small molecular drug D0JB3H
Ot-551 Small molecular drug D0P1IX
Abt-rta-408 . D0K7NI
Sfx-01 . D02NMR
Phase 1
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Hpp971 Small molecular drug D9ZEM7
Preclinical
Click To Hide/Show 3 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cat4001 Small molecular drug D24EPJ
Tfm735 Small molecular drug DPJ05C
M102 . DA85KQ
Patented
Click To Hide/Show 62 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
1,2,3,4-tetrahydroisoquinoline Derivative 1 Small molecular drug D0WR1I
1-phenyl-1,3,4-triazole Derivative 1 Small molecular drug D09MSN
1-phenyl-1,3,4-triazole Derivative 2 Small molecular drug D0AR0L
1-phenyl-1,3,4-triazole Derivative 3 Small molecular drug D0I2DV
2-hydroxybenzamide Derivative 1 Small molecular drug D02YNU
2-hydroxybenzamide Derivative 2 Small molecular drug D0VW9H
3-phenyl Propanoic Derivative 1 Small molecular drug D0O6LW
3-phenyl Propanoic Derivative 2 Small molecular drug D0MS7G
3-phenyl Propanoic Derivative 3 Small molecular drug D0Q8JZ
4-(2-cyclohexylethoxy) Aniline Derivative 1 Small molecular drug D0R2AI
4-(2-cyclohexylethoxy) Aniline Derivative 2 Small molecular drug D0ND6T
4-(2-cyclohexylethoxy) Aniline Derivative 3 Small molecular drug D06KOH
4-(2-cyclohexylethoxy) Aniline Derivative 4 Small molecular drug D0T7WW
Benzamide Derivative 5 Small molecular drug D0DE0Y
Benzamide Derivative 6 Small molecular drug D00PGP
Benzo[D]Oxazole Derivative 1 Small molecular drug D03RTM
Benzo[D]Oxazole Derivative 2 Small molecular drug D07TEZ
Benzo[D]Oxazole Derivative 3 Small molecular drug D0G8CF
Benzo[D]Oxazole Derivative 4 Small molecular drug D0M2ZX
Chalcone Derivative 1 Small molecular drug D0U9TR
Chalcone Derivative 2 Small molecular drug D0EO3S
Chalcone Derivative 3 Small molecular drug D0G1LS
Chalcone Derivative 4 Small molecular drug D02SPI
Diterpenoid Derivative 1 Small molecular drug D09FZF
Diterpenoid Derivative 2 Small molecular drug D0Q9QQ
Naphthalene Derivative 1 Small molecular drug D02FWA
Pmid28454500-compound-10 Small molecular drug D0WN1Y
Pmid28454500-compound-11 Small molecular drug D0RM4V
Pmid28454500-compound-12 Small molecular drug D0AX4Q
Pmid28454500-compound-13 Small molecular drug D0AJ2T
Pmid28454500-compound-3 Small molecular drug D0JH8Z
Pmid28454500-compound-32 Small molecular drug D0L1JQ
Pmid28454500-compound-33 Small molecular drug D0FM3Q
Pmid28454500-compound-34 Small molecular drug D0FH6P
Pmid28454500-compound-35 Small molecular drug D0MX0Q
Pmid28454500-compound-36 Small molecular drug D01PKZ
Pmid28454500-compound-37 Small molecular drug D0SA1N
Pmid28454500-compound-40 Small molecular drug D0MQ3X
Pmid28454500-compound-41 Small molecular drug D0C1PB
Pmid28454500-compound-49 Small molecular drug D0N1VC
Pmid28454500-compound-50 Small molecular drug D0G4EK
Pmid28454500-compound-57 Small molecular drug D00TVL
Pmid28454500-compound-58 Small molecular drug D02JFV
Pmid28454500-compound-59 Small molecular drug D0O3KN
Pmid28454500-compound-60 Small molecular drug D0LL7V
Pmid28454500-compound-8 Small molecular drug D01GTU
Pmid28454500-compound-9 Small molecular drug D0N9GH
Pmid28454500-compound-91 Small molecular drug D0PF4H
Pmid28454500-compound-92 Small molecular drug D05EMI
Pmid28454500-compound-93 Small molecular drug D04YKV
Pmid28454500-compound-94 Small molecular drug D0P9ZD
Pmid28454500-compound-95 Small molecular drug D0RO7A
Pmid28454500-compound-96 Small molecular drug D0O5ZK
Pyrazino[2,1-a]Isoquinolin Derivative 1 Small molecular drug D0AZ8T
Pyrazino[2,1-a]Isoquinolin Derivative 2 Small molecular drug D06LEF
Pyrazino[2,1-a]Isoquinolin Derivative 3 Small molecular drug D0VA2G
Pyrazino[2,1-a]Isoquinolin Derivative 4 Small molecular drug D01MZI
Pyridyl Compound 1 Small molecular drug D0KX0J
Thiazole Derivative 2 Small molecular drug D0T2LN
Thiazole Derivative 3 Small molecular drug D0D8KO
Trepenoid Derivative 1 Small molecular drug D0XL2V
Vinyl Sulfone Derivative 1 Small molecular drug D04ILM

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840