Details of the Target
General Information of Target
| Target ID | LDTP06512 | |||||
|---|---|---|---|---|---|---|
| Target Name | Beta-synuclein (SNCB) | |||||
| Gene Name | SNCB | |||||
| Gene ID | 6620 | |||||
| Synonyms |
Beta-synuclein |
|||||
| 3D Structure | ||||||
| Sequence |
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTK
EQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYE DPPQEEYQEYEPEA |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Synuclein family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Non-amyloid component of senile plaques found in Alzheimer disease. Could act as a regulator of SNCA aggregation process. Protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA)-stimulated caspase activation in a p53/TP53-dependent manner. Contributes to restore the SNCA anti-apoptotic function abolished by 6OHDA. Not found in the Lewy bodies associated with Parkinson disease.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HHS-475 Probe Info |
![]() |
Y39(0.97) | LDD0264 | [1] | |
|
HHS-465 Probe Info |
![]() |
Y39(0.00); K43(0.00) | LDD2240 | [2] | |
Competitor(s) Related to This Target
References


