Details of the Target
General Information of Target
| Target ID | LDTP06458 | |||||
|---|---|---|---|---|---|---|
| Target Name | CCAAT/enhancer-binding protein epsilon (CEBPE) | |||||
| Gene Name | CEBPE | |||||
| Gene ID | 1053 | |||||
| Synonyms |
CCAAT/enhancer-binding protein epsilon; C/EBP epsilon |
|||||
| 3D Structure | ||||||
| Sequence |
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAV
KPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAV KEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPC SPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYM AENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
BZIP family, C/EBP subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcriptional activator. C/EBP are DNA-binding proteins that recognize two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Required for the promyelocyte-myelocyte transition in myeloid differentiation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0032 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transcription factor

