Details of the Target
General Information of Target
| Target ID | LDTP06396 | |||||
|---|---|---|---|---|---|---|
| Target Name | Nuclear receptor subfamily 0 group B member 2 (NR0B2) | |||||
| Gene Name | NR0B2 | |||||
| Gene ID | 8431 | |||||
| Synonyms |
SHP; Nuclear receptor subfamily 0 group B member 2; Orphan nuclear receptor SHP; Small heterodimer partner |
|||||
| 3D Structure | ||||||
| Sequence |
MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREAL
DVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKK ILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVP GLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPI IGDVDIAGLLGDMLLLR |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Nuclear hormone receptor family, NR0 subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcriptional regulator that acts as a negative regulator of receptor-dependent signaling pathways. Specifically inhibits transactivation of the nuclear receptor with which it interacts. Inhibits transcriptional activity of NEUROD1 on E-box-containing promoter by interfering with the coactivation function of the p300/CBP-mediated transcription complex for NEUROD1. Essential component of the liver circadian clock which via its interaction with NR1D1 and RORG regulates NPAS2-mediated hepatic lipid metabolism. Regulates the circadian expression of cytochrome P450 (CYP) enzymes. Represses: NR5A2 and HNF4A to down-regulate CYP2C38, NFLI3 to up-regulate CYP2A5, BHLHE41/HNF1A axis to up-regulate CYP1A2, CYP2E1 and CYP3A11, and NR1D1 to up-regulate CYP2B10, CYP4A10 and CYP4A14.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
 |
C168(0.81) | LDD2109 | [1] | |
Competitor(s) Related to This Target