Details of the Target

General Information of Target

Target ID LDTP06392
Target Name Cytohesin-1 (CYTH1)
Gene Name CYTH1
Gene ID 9267
Synonyms
D17S811E; PSCD1; Cytohesin-1; PH, SEC7 and coiled-coil domain-containing protein 1; SEC7 homolog B2-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE
PRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAP
TPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Target Bioclass
Other
Subcellular location
Cell membrane
Function
Promotes guanine-nucleotide exchange on ARF1, ARF5 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. Plays an important role in membrane trafficking, during junctional remodeling and epithelial polarization, through regulation of ARF6 activity.
Uniprot ID
Q15438
Ensemble ID
ENST00000446868.8
HGNC ID
HGNC:9501

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CHL1 SNV: p.E21K DBIA    Probe Info 
KPL1 SNV: p.E40K DBIA    Probe Info 
MCF7 SNV: p.E40K .
NCIH358 SNV: p.S199N .
SHP77 SNV: p.P247R DBIA    Probe Info 
SKMEL24 SNV: p.S394F DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 7 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K38(20.00)  LDD2218  [1]
DBIA
 Probe Info  		C94(2.74)  LDD3319  [2]
ATP probe
 Probe Info  		N.A.  LDD0199  [3]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [4]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [4]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [4]
IPM
 Probe Info  		N.A.  LDD2156  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0215  AC10 HEK-293T C94(1.07)  LDD1508  [6]
 LDCM0277  AC18 HEK-293T C94(0.96)  LDD1516  [6]
 LDCM0279  AC2 HEK-293T C94(0.94)  LDD1518  [6]
 LDCM0286  AC26 HEK-293T C94(0.88)  LDD1525  [6]
 LDCM0295  AC34 HEK-293T C94(0.92)  LDD1534  [6]
 LDCM0304  AC42 HEK-293T C94(0.87)  LDD1543  [6]
 LDCM0313  AC50 HEK-293T C94(0.87)  LDD1552  [6]
 LDCM0321  AC58 HEK-293T C94(0.93)  LDD1560  [6]
 LDCM0405  CL18 HEK-293T C94(1.02)  LDD1609  [6]
 LDCM0419  CL30 HEK-293T C94(1.02)  LDD1623  [6]
 LDCM0432  CL42 HEK-293T C94(1.02)  LDD1636  [6]
 LDCM0445  CL54 HEK-293T C94(1.02)  LDD1648  [6]
 LDCM0451  CL6 HEK-293T C94(0.89)  LDD1654  [6]
 LDCM0458  CL66 HEK-293T C94(0.84)  LDD1661  [6]
 LDCM0471  CL78 HEK-293T C94(0.93)  LDD1674  [6]
 LDCM0485  CL90 HEK-293T C94(0.91)  LDD1688  [6]
 LDCM0625  F8 Ramos C94(2.07)  LDD2187  [7]
 LDCM0576  Fragment14 Ramos C94(1.10)  LDD2193  [7]
 LDCM0566  Fragment4 Ramos C94(0.87)  LDD2184  [7]
 LDCM0569  Fragment7 Ramos C94(0.80)  LDD2186  [7]
 LDCM0022  KB02 697 C94(1.21)  LDD2245  [2]
 LDCM0023  KB03 697 C94(1.12)  LDD2662  [2]
 LDCM0024  KB05 MEWO C94(2.74)  LDD3319  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cystathionine beta-synthase (CBS) Cysteine synthase/cystathionine beta-synthase family P35520
Heat shock protein HSP 90-alpha (HSP90AA1) Heat shock protein 90 family P07900
RAC-alpha serine/threonine-protein kinase (AKT1) AGC Ser/Thr protein kinase family P31749
E3 ubiquitin-protein ligase CHIP (STUB1) . Q9UNE7
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gamma-secretase subunit APH-1A (APH1A) APH-1 family Q96BI3
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Fos-related antigen 2 (FOSL2) BZIP family P15408
Other
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Connector enhancer of kinase suppressor of ras 1 (CNKSR1) CNKSR family Q969H4
Gamma-secretase subunit PEN-2 (PSENEN) PEN-2 family Q9NZ42
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Cytohesin-interacting protein (CYTIP) . O60759
Innate immunity activator protein (INAVA) . Q3KP66
Interactor protein for cytohesin exchange factors 1 (IPCEF1) . Q8WWN9

References

1 Global profiling of lysine reactivity and ligandability in the human proteome. Nat Chem. 2017 Dec;9(12):1181-1190. doi: 10.1038/nchem.2826. Epub 2017 Jul 31.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
4 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
5 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
6 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
7 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578