Details of the Target
General Information of Target
| Target ID | LDTP06392 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cytohesin-1 (CYTH1) | |||||
| Gene Name | CYTH1 | |||||
| Gene ID | 9267 | |||||
| Synonyms |
D17S811E; PSCD1; Cytohesin-1; PH, SEC7 and coiled-coil domain-containing protein 1; SEC7 homolog B2-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVF QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE PRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAP TPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Promotes guanine-nucleotide exchange on ARF1, ARF5 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. Plays an important role in membrane trafficking, during junctional remodeling and epithelial polarization, through regulation of ARF6 activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| CHL1 | SNV: p.E21K | DBIA Probe Info | |||
| KPL1 | SNV: p.E40K | DBIA Probe Info | |||
| MCF7 | SNV: p.E40K | . | |||
| NCIH358 | SNV: p.S199N | . | |||
| SHP77 | SNV: p.P247R | DBIA Probe Info | |||
| SKMEL24 | SNV: p.S394F | DBIA Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K38(20.00) | LDD2218 | [1] | |
|
DBIA Probe Info |
![]() |
C94(2.74) | LDD3319 | [2] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [3] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [4] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [4] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [4] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0215 | AC10 | HEK-293T | C94(1.07) | LDD1508 | [6] |
| LDCM0277 | AC18 | HEK-293T | C94(0.96) | LDD1516 | [6] |
| LDCM0279 | AC2 | HEK-293T | C94(0.94) | LDD1518 | [6] |
| LDCM0286 | AC26 | HEK-293T | C94(0.88) | LDD1525 | [6] |
| LDCM0295 | AC34 | HEK-293T | C94(0.92) | LDD1534 | [6] |
| LDCM0304 | AC42 | HEK-293T | C94(0.87) | LDD1543 | [6] |
| LDCM0313 | AC50 | HEK-293T | C94(0.87) | LDD1552 | [6] |
| LDCM0321 | AC58 | HEK-293T | C94(0.93) | LDD1560 | [6] |
| LDCM0405 | CL18 | HEK-293T | C94(1.02) | LDD1609 | [6] |
| LDCM0419 | CL30 | HEK-293T | C94(1.02) | LDD1623 | [6] |
| LDCM0432 | CL42 | HEK-293T | C94(1.02) | LDD1636 | [6] |
| LDCM0445 | CL54 | HEK-293T | C94(1.02) | LDD1648 | [6] |
| LDCM0451 | CL6 | HEK-293T | C94(0.89) | LDD1654 | [6] |
| LDCM0458 | CL66 | HEK-293T | C94(0.84) | LDD1661 | [6] |
| LDCM0471 | CL78 | HEK-293T | C94(0.93) | LDD1674 | [6] |
| LDCM0485 | CL90 | HEK-293T | C94(0.91) | LDD1688 | [6] |
| LDCM0625 | F8 | Ramos | C94(2.07) | LDD2187 | [7] |
| LDCM0576 | Fragment14 | Ramos | C94(1.10) | LDD2193 | [7] |
| LDCM0566 | Fragment4 | Ramos | C94(0.87) | LDD2184 | [7] |
| LDCM0569 | Fragment7 | Ramos | C94(0.80) | LDD2186 | [7] |
| LDCM0022 | KB02 | 697 | C94(1.21) | LDD2245 | [2] |
| LDCM0023 | KB03 | 697 | C94(1.12) | LDD2662 | [2] |
| LDCM0024 | KB05 | MEWO | C94(2.74) | LDD3319 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Gamma-secretase subunit APH-1A (APH1A) | APH-1 family | Q96BI3 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Fos-related antigen 2 (FOSL2) | BZIP family | P15408 | |||
Other
References







