General Information of Target

Target ID LDTP06319
Target Name Programmed cell death protein 1 (PDCD1)
Gene Name PDCD1
Gene ID 5133
Synonyms
PD1; Programmed cell death protein 1; Protein PD-1; hPD-1; CD antigen CD279
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
Target Type
Successful
Target Bioclass
Immunoglobulin
Subcellular location
Cell membrane
Function
Inhibitory receptor on antigen activated T-cells that plays a critical role in induction and maintenance of immune tolerance to self. Delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2. Following T-cell receptor (TCR) engagement, PDCD1 associates with CD3-TCR in the immunological synapse and directly inhibits T-cell activation. Suppresses T-cell activation through the recruitment of PTPN11/SHP-2: following ligand-binding, PDCD1 is phosphorylated within the ITSM motif, leading to the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta.; The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival. The interaction with CD274/PDCD1L1 inhibits cytotoxic T lymphocytes (CTLs) effector function. The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy.
TTD ID
T59631
Uniprot ID
Q15116
DrugMap ID
TTVLU5N
Ensemble ID
ENST00000334409.10
HGNC ID
HGNC:8760
ChEMBL ID
CHEMBL3307223

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C93(1.71)  LDD3397  [1]
IA-alkyne
 Probe Info 
C93(10.62)  LDD1704  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 T cell-activated C93(10.62)  LDD1704  [2]
 LDCM0023  KB03 JeKo-1 C93(2.47)  LDD2820  [1]
 LDCM0024  KB05 PF-382 C93(1.71)  LDD3397  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Tyrosine-protein phosphatase non-receptor type 11 (PTPN11) Protein-tyrosine phosphatase family Q06124
Immunoglobulin
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Programmed cell death 1 ligand 1 (CD274) BTN/MOG family Q9NZQ7
Programmed cell death 1 ligand 2 (PDCD1LG2) BTN/MOG family Q9BQ51

The Drug(s) Related To This Target

Approved
Click To Hide/Show 10 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Dostarlimab Antibody DGQU43
Sintilimab Antibody DFLK16
Atezolizumab Monoclonal antibody DB11595
Avelumab Monoclonal antibody DB11945
Cemiplimab Monoclonal antibody D0KG4Q
Durvalumab Monoclonal antibody DB11714
Mk-3475 Monoclonal antibody D07DMY
Nivolumab Monoclonal antibody D00GOV
Pembrolizumab Monoclonal antibody D08ANZ
Tislelizumab Monoclonal antibody D02KSP
Phase 3
Click To Hide/Show 7 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Mga012 Antibody D0PG5O
Pdr001 Antibody D05BAJ
Sasanlimab Antibody DP2Z0X
Ibi-308 Monoclonal antibody D0B0UF
Incshr1210 Monoclonal antibody D0BO0K
Spartalizumab Monoclonal antibody D08JLH
Bgb-a317 . D08HWV
Phase 2
Click To Hide/Show 8 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Ak104 Antibody DXJH93
Cetrelimab Antibody DQ43PA
Jtx-4014 Antibody DZMO76
M7824 Antibody D05FPZ
Mgd013 Antibody D0MY0F
Ro7121661 Antibody DQM48O
Agen2034 Monoclonal antibody D0WJ7H
Jnj 63723283 Monoclonal antibody D08UGS
Phase 1
Click To Hide/Show 25 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
609a Antibody DL1XC2
Adpt01 Antibody DMEQ73
Amg 404 Antibody D5T6DY
Apl-501 Antibody DVO4H2
Bi 754091 Antibody DDKY53
Cc-90006 Antibody D0L5ZH
Cdx-527 Antibody D28MNU
Gsk2661380 Antibody D03XRA
Ibi318 Antibody DX30BA
Medi5752 Antibody D7L1MP
Mgd019 Antibody D1PYC8
Pf-06801591 Antibody D05BPO
Rg6139 Antibody D4CGN3
Si-b003 Antibody D1S7EP
Syn125 Antibody DG4YF6
Xmab20717 Antibody DD1TJ8
Xmab23104 Antibody D8FJ9K
Amp-224 Monoclonal antibody D00JMY
Bi-754091 Monoclonal antibody D00NEL
Lzm009 Monoclonal antibody D0BX5L
Medi0680 Monoclonal antibody D01CXW
Sym021 Monoclonal antibody D0D4TC
Tsr-042 Monoclonal antibody D0N5VK
Rg6279 Recombinant protein D5WB0F
Cbt-501 . D0Y3ZC
Preclinical
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Aunp-12 Peptide D04QQG
Investigative
Click To Hide/Show 18 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Camrelizumab Monoclonal antibody DB14776
Pmid30247903-compound-general Structure13 Small molecular drug D07FEF
Pmid30247903-compound-general Structure14 Small molecular drug D0E4UM
Pmid30247903-compound-general Structure15 Small molecular drug D0T9HE
Pmid30247903-compound-general Structure16 Small molecular drug D0UJ9J
Pmid30247903-compound-general Structure17 Small molecular drug D0D8DV
Pmid30247903-compound-general Structure20 Small molecular drug D0BX6Z
Pmid30247903-compound-general Structure21 Small molecular drug D0L1BZ
Pmid30247903-compound-general Structure22 Small molecular drug D0BU2V
Pmid30247903-compound-general Structure23 Small molecular drug D0N6MD
Pmid30247903-compound-general Structure24 Small molecular drug D0L0DQ
Pmid30247903-compound-general Structure25 Small molecular drug D04BON
Budigalimab . DB16668
Ct-011 . DB05916
Geptanolimab . DB16417
Prolgolimab . DB16740
Retifanlimab . DB15766
Toripalimab . DB15043
Patented
Click To Hide/Show 9 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
1,2,4-oxadiazole Derivative 1 Small molecular drug D0MZ4V
1,2,4-oxadiazole Derivative 2 Small molecular drug D03PSA
1,3,4-oxadiazole Derivative 1 Small molecular drug D0LM6D
1,3,4-oxadiazole Derivative 2 Small molecular drug D0P3EG
Cyclic Compound 1 Small molecular drug D03XZT
Cyclic Compound 2 Small molecular drug D07PJR
Cyclic Compound 3 Small molecular drug D00ZRO
Pmid30107136-compound-example15 Small molecular drug D08VDV
Pmid30107136-compound-example16 Small molecular drug D0K7NC

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.