Details of the Target
General Information of Target
| Target ID | LDTP06289 | |||||
|---|---|---|---|---|---|---|
| Target Name | DAZ-associated protein 2 (DAZAP2) | |||||
| Gene Name | DAZAP2 | |||||
| Gene ID | 9802 | |||||
| Synonyms |
KIAA0058; PRTB; DAZ-associated protein 2; Deleted in azoospermia-associated protein 2; Proline-rich transcript in brain protein |
|||||
| 3D Structure | ||||||
| Sequence |
MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPT
MSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGA TAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
In unstressed cells, promotes SIAH1-mediated polyubiquitination and degradation of the serine/threonine-protein kinase HIPK2, probably by acting as a loading factor that potentiates complex formation between HIPK2 and ubiquitin ligase SIAH1. In response to DNA damage, localizes to the nucleus following phosphorylation by HIPK2 and modulates the expression of a subset of TP53/p53 target genes by binding to TP53 at target gene promoters. This limits the expression of a number of cell death-mediating TP53 target genes, reducing DNA damage-induced cell death. Enhances the binding of transcription factor TCF7L2/TCF4, a Wnt signaling pathway effector, to the promoters of target genes. Plays a role in stress granule formation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
 |
N.A. | LDD2225 | [1] | |