Details of the Target
General Information of Target
| Target ID | LDTP06135 | |||||
|---|---|---|---|---|---|---|
| Target Name | Hyaluronan-binding protein 2 (HABP2) | |||||
| Gene Name | HABP2 | |||||
| Gene ID | 3026 | |||||
| Synonyms |
HGFAL; PHBP; Hyaluronan-binding protein 2; EC 3.4.21.-; Factor VII-activating protease; Factor seven-activating protease; FSAP; Hepatocyte growth factor activator-like protein; Plasma hyaluronan-binding protein) [Cleaved into: Hyaluronan-binding protein 2 50 kDa heavy chain; Hyaluronan-binding protein 2 50 kDa heavy chain alternate form; Hyaluronan-binding protein 2 27 kDa light chain; Hyaluronan-binding protein 2 27 kDa light chain alternate form]
|
|||||
| 3D Structure | ||||||
| Sequence |
MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLT
HAENPDWYYTEDQADPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPC GRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPD QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGI GEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQDVAYPEESPTEPSTKLPGFDS CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTA AHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSR QLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVY TQVTKFLNWIKATIKSESGF |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Peptidase S1 family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Cleaves the alpha-chain at multiple sites and the beta-chain between 'Lys-53' and 'Lys-54' but not the gamma-chain of fibrinogen and therefore does not initiate the formation of the fibrin clot and does not cause the fibrinolysis directly. It does not cleave (activate) prothrombin and plasminogen but converts the inactive single chain urinary plasminogen activator (pro-urokinase) to the active two chain form. Activates coagulation factor VII. May function as a tumor suppressor negatively regulating cell proliferation and cell migration.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| A498 | SNV: p.S399G | . | |||
| CORL23 | Insertion: p.V374GfsTer14 | . | |||
| DU145 | SNV: p.D488Y | . | |||
| EFO21 | SNV: p.I395M | . | |||
| HCT15 | SNV: p.Q542H | . | |||
| HEC1 | SNV: p.G495Ter | . | |||
| HUPT3 | SNV: p.Y195C | . | |||
| ICC137 | SNV: p.H353D | DBIA Probe Info | |||
| KYSE180 | SNV: p.C187S | . | |||
| LS180 | SNV: p.G239W | . | |||
| NCIH196 | Insertion: p.Q160PfsTer10 | . | |||
| OVTOKO | SNV: p.A214E | . | |||
| RKO | Deletion: p.V392del | . | |||
| RPMI7951 | SNV: p.H409Y | . | |||
| SHP77 | SNV: p.G458E | . | |||
| SKMEL2 | SNV: p.D299E | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C424(2.27) | LDD3316 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C424(7.21) | LDD1704 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References


