Details of the Target
General Information of Target
| Target ID | LDTP06129 | |||||
|---|---|---|---|---|---|---|
| Target Name | ATP-sensitive inward rectifier potassium channel 12 (KCNJ12) | |||||
| Gene Name | KCNJ12 | |||||
| Gene ID | 3768 | |||||
| Synonyms |
IRK2; KCNJN1; ATP-sensitive inward rectifier potassium channel 12; Inward rectifier K(+) channel Kir2.2; IRK-2; Inward rectifier K(+) channel Kir2.2v; Potassium channel, inwardly rectifying subfamily J member 12
|
|||||
| 3D Structure | ||||||
| Sequence |
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGR TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG VLEQRPYRRESEI |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ12 subfamily
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Inward rectifying potassium channel that is activated by phosphatidylinositol 4,5-bisphosphate and that probably participates in controlling the resting membrane potential in electrically excitable cells. Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [1] | |

