Details of the Target
General Information of Target
| Target ID | LDTP06031 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ras-related protein Rab-33A (RAB33A) | |||||
| Gene Name | RAB33A | |||||
| Gene ID | 9363 | |||||
| Synonyms |
RABS10; Ras-related protein Rab-33A; Small GTP-binding protein S10 |
|||||
| 3D Structure | ||||||
| Sequence |
MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGT
FPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVT KMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFET SAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Small GTPase superfamily, Rab family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C57(2.91); C135(1.55) | LDD3332 | [1] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [2] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [3] | |
|
IA-alkyne Probe Info |
![]() |
C57(0.00); C135(0.00) | LDD0036 | [3] | |
|
Lodoacetamide azide Probe Info |
![]() |
C57(0.00); C135(0.00) | LDD0037 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase SIAH1 (SIAH1) | SINA (Seven in absentia) family | Q8IUQ4 | |||
| E3 ubiquitin-protein ligase LNX (LNX1) | . | Q8TBB1 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Prenylated Rab acceptor protein 1 (RABAC1) | PRA1 family | Q9UI14 | |||
| Autophagy-related protein 16-1 (ATG16L1) | WD repeat ATG16 family | Q676U5 | |||
Other
References





