Details of the Target
General Information of Target
| Target ID | LDTP05999 | |||||
|---|---|---|---|---|---|---|
| Target Name | Krueppel-like factor 9 (KLF9) | |||||
| Gene Name | KLF9 | |||||
| Gene ID | 687 | |||||
| Synonyms |
BTEB; BTEB1; Krueppel-like factor 9; Basic transcription element-binding protein 1; BTE-binding protein 1; GC-box-binding protein 1; Transcription factor BTEB1 |
|||||
| 3D Structure | ||||||
| Sequence |
MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTL
VTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSA PSPLSLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDC LKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSMIKRSKKAL ANAL |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Sp1 C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription factor that binds to GC box promoter elements. Selectively activates mRNA synthesis from genes containing tandem repeats of GC boxes but represses genes with a single GC box. Acts as an epidermal circadian transcription factor regulating keratinocyte proliferation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [1] | |

