Details of the Target

General Information of Target

Target ID LDTP05899
Target Name Mediator of RNA polymerase II transcription subunit 21 (MED21)
Gene Name MED21
Gene ID 9412
Synonyms
SRB7; SURB7; Mediator of RNA polymerase II transcription subunit 21; Mediator complex subunit 21; RNA polymerase II holoenzyme component SRB7; RNAPII complex component SRB7; hSrb7
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFNNIQTAINKDQPANPTEEYAQLFAA
LIARTAKDIDVLIDSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQS
ALADIAQSQLKTRSGTHSQSLPDS
Target Bioclass
Enzyme
Family
Mediator complex subunit 21 family
Subcellular location
Nucleus
Function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Uniprot ID
Q13503
Ensemble ID
ENST00000282892.4
HGNC ID
HGNC:11473

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		C103(5.10)  LDD2157  [1]
DBIA
 Probe Info  		C103(0.84)  LDD1509  [2]
IPM
 Probe Info  		N.A.  LDD2156  [3]
NAIA_5
 Probe Info  		N.A.  LDD2223  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0226  AC11 HEK-293T C103(0.84)  LDD1509  [2]
 LDCM0278  AC19 HEK-293T C103(1.04)  LDD1517  [2]
 LDCM0281  AC21 HEK-293T C103(1.15)  LDD1520  [2]
 LDCM0287  AC27 HEK-293T C103(0.90)  LDD1526  [2]
 LDCM0289  AC29 HEK-293T C103(1.12)  LDD1528  [2]
 LDCM0290  AC3 HEK-293T C103(0.87)  LDD1529  [2]
 LDCM0296  AC35 HEK-293T C103(1.02)  LDD1535  [2]
 LDCM0298  AC37 HEK-293T C103(1.59)  LDD1537  [2]
 LDCM0305  AC43 HEK-293T C103(1.12)  LDD1544  [2]
 LDCM0307  AC45 HEK-293T C103(0.83)  LDD1546  [2]
 LDCM0312  AC5 HEK-293T C103(1.16)  LDD1551  [2]
 LDCM0314  AC51 HEK-293T C103(0.98)  LDD1553  [2]
 LDCM0316  AC53 HEK-293T C103(1.13)  LDD1555  [2]
 LDCM0322  AC59 HEK-293T C103(1.21)  LDD1561  [2]
 LDCM0325  AC61 HEK-293T C103(1.03)  LDD1564  [2]
 LDCM0248  AKOS034007472 HEK-293T C103(0.81)  LDD1511  [2]
 LDCM0632  CL-Sc Hep-G2 C103(3.23)  LDD2227  [4]
 LDCM0371  CL102 HEK-293T C103(0.89)  LDD1575  [2]
 LDCM0375  CL106 HEK-293T C103(0.90)  LDD1579  [2]
 LDCM0380  CL110 HEK-293T C103(0.91)  LDD1584  [2]
 LDCM0384  CL114 HEK-293T C103(1.15)  LDD1588  [2]
 LDCM0388  CL118 HEK-293T C103(1.18)  LDD1592  [2]
 LDCM0393  CL122 HEK-293T C103(1.06)  LDD1597  [2]
 LDCM0397  CL126 HEK-293T C103(1.03)  LDD1601  [2]
 LDCM0401  CL14 HEK-293T C103(0.91)  LDD1605  [2]
 LDCM0406  CL19 HEK-293T C103(0.99)  LDD1610  [2]
 LDCM0407  CL2 HEK-293T C103(1.06)  LDD1611  [2]
 LDCM0409  CL21 HEK-293T C103(1.65)  LDD1613  [2]
 LDCM0414  CL26 HEK-293T C103(0.93)  LDD1618  [2]
 LDCM0420  CL31 HEK-293T C103(0.84)  LDD1624  [2]
 LDCM0422  CL33 HEK-293T C103(1.69)  LDD1626  [2]
 LDCM0433  CL43 HEK-293T C103(1.30)  LDD1637  [2]
 LDCM0435  CL45 HEK-293T C103(0.92)  LDD1639  [2]
 LDCM0441  CL50 HEK-293T C103(0.96)  LDD1645  [2]
 LDCM0446  CL55 HEK-293T C103(0.97)  LDD1649  [2]
 LDCM0448  CL57 HEK-293T C103(1.47)  LDD1651  [2]
 LDCM0454  CL62 HEK-293T C103(1.03)  LDD1657  [2]
 LDCM0459  CL67 HEK-293T C103(1.26)  LDD1662  [2]
 LDCM0461  CL69 HEK-293T C103(1.08)  LDD1664  [2]
 LDCM0462  CL7 HEK-293T C103(0.96)  LDD1665  [2]
 LDCM0467  CL74 HEK-293T C103(1.08)  LDD1670  [2]
 LDCM0472  CL79 HEK-293T C103(1.15)  LDD1675  [2]
 LDCM0475  CL81 HEK-293T C103(1.37)  LDD1678  [2]
 LDCM0480  CL86 HEK-293T C103(1.30)  LDD1683  [2]
 LDCM0484  CL9 HEK-293T C103(1.39)  LDD1687  [2]
 LDCM0486  CL91 HEK-293T C103(1.00)  LDD1689  [2]
 LDCM0488  CL93 HEK-293T C103(0.91)  LDD1691  [2]
 LDCM0493  CL98 HEK-293T C103(1.21)  LDD1696  [2]
 LDCM0427  Fragment51 HEK-293T C103(0.99)  LDD1631  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (SSC5D) . A1L4H1
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Tripartite motif-containing protein 72 (TRIM72) TRIM/RBCC family Q6ZMU5
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 655 (ZNF655) Krueppel C2H2-type zinc-finger protein family Q8N720
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Limbic system-associated membrane protein (LSAMP) IgLON family Q13449
Other
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Biogenesis of lysosome-related organelles complex 1 subunit 6 (BLOC1S6) BLOC1S6 family Q9UL45
BLOC-1-related complex subunit 6 (BORCS6) BORCS6 family Q96GS4
Mediator of RNA polymerase II transcription subunit 1 (MED1) Mediator complex subunit 1 family Q15648
Mediator of RNA polymerase II transcription subunit 4 (MED4) Mediator complex subunit 4 family Q9NPJ6
Mediator of RNA polymerase II transcription subunit 7 (MED7) Mediator complex subunit 7 family O43513
Mediator of RNA polymerase II transcription subunit 9 (MED9) Mediator complex subunit 9 family Q9NWA0
Mitochondrial dynamics protein MIEF1 (MIEF1) SMCR7 family Q9NQG6
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Melanoma-associated antigen B4 (MAGEB4) . O15481

References

1 From chemoproteomic-detected amino acids to genomic coordinates: insights into precise multi-omic data integration. Mol Syst Biol. 2021 Feb;17(2):e9840. doi: 10.15252/msb.20209840.
Mass spectrometry data entry: PXD022151
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
3 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264