Details of the Target
General Information of Target
| Target ID | LDTP05880 | |||||
|---|---|---|---|---|---|---|
| Target Name | Forkhead box protein E3 (FOXE3) | |||||
| Gene Name | FOXE3 | |||||
| Gene ID | 2301 | |||||
| Synonyms |
FKHL12; FREAC8; Forkhead box protein E3; Forkhead-related protein FKHL12; Forkhead-related transcription factor 8; FREAC-8 |
|||||
| 3D Structure | ||||||
| Sequence |
MAGRSDMDPPAAFSGFPALPAVAPSGPPPSPLAGAEPGREPEEAAAGRGEAAPTPAPGPG
RRRRRPLQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIR HNLTLNDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRAELPAHAAAAP GPPLPFPYAPYAPAPGPALLVPPPSAGPGPSPPARLFSVDSLVNLQPELAGLGAPEPPCC AAPDAAAAAFPPCAAAASPPLYSQVPDRLVLPATRPGPGPLPAEPLLALAGPAAALGPLS PGEAYLRQPGFASGLERYL |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription factor that controls lens epithelial cell growth through regulation of proliferation, apoptosis and cell cycle. During lens development, controls the ratio of the lens fiber cells to the cells of the anterior lens epithelium by regulating the rate of proliferation and differentiation. Controls lens vesicle closure and subsequent separation of the lens vesicle from ectoderm. Controls the expression of DNAJB1 in a pathway that is crucial for the development of the anterior segment of the eye.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0222 | [1] | |
Competitor(s) Related to This Target

