Details of the Target
General Information of Target
| Target ID | LDTP05876 | |||||
|---|---|---|---|---|---|---|
| Target Name | Limbic system-associated membrane protein (LSAMP) | |||||
| Gene Name | LSAMP | |||||
| Gene ID | 4045 | |||||
| Synonyms |
IGLON3; LAMP; Limbic system-associated membrane protein; LSAMP; IgLON family member 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNS
KVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPK TSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEE YLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCE ASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTN ASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC |
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Family |
Immunoglobulin superfamily, IgLON family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hippocampal mossy fiber projection.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Mediator of RNA polymerase II transcription subunit 21 (MED21) | Mediator complex subunit 21 family | Q13503 | |||
| Methyltransferase-like protein 27 (METTL27) | . | Q8N6F8 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Beclin-1 (BECN1) | Beclin family | Q14457 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| ETS domain-containing protein Elk-3 (ELK3) | ETS family | P41970 | |||
| THAP domain-containing protein 3 (THAP3) | . | Q8WTV1 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Neuronal growth regulator 1 (NEGR1) | IgLON family | Q7Z3B1 | |||
| Neurotrimin (NTM) | IgLON family | Q9P121 | |||
Other

