Details of the Target
General Information of Target
| Target ID | LDTP05826 | |||||
|---|---|---|---|---|---|---|
| Target Name | Bcl-2-interacting killer (BIK) |
|
||||
| Gene Name | BIK | |||||
| Gene ID | 638 | |||||
| Synonyms |
NBK; Bcl-2-interacting killer; Apoptosis inducer NBK; BIP1; BP4 |
|||||
| 3D Structure | ||||||
| Sequence |
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR
LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Endomembrane system
|
|||||
| Function |
Accelerates programmed cell death. Association to the apoptosis repressors Bcl-X(L), BHRF1, Bcl-2 or its adenovirus homolog E1B 19k protein suppresses this death-promoting activity. Does not interact with BAX.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C63(1.12) | LDD2182 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0573 | Fragment11 | Ramos | C63(5.34) | LDD2190 | [1] |
| LDCM0576 | Fragment14 | Ramos | C63(0.95) | LDD2193 | [1] |
| LDCM0586 | Fragment28 | Ramos | C63(1.12) | LDD2198 | [1] |
| LDCM0569 | Fragment7 | Ramos | C63(2.06) | LDD2186 | [1] |
| LDCM0022 | KB02 | Ramos | C63(1.12) | LDD2182 | [1] |
| LDCM0023 | KB03 | Ramos | C63(1.52) | LDD2183 | [1] |
| LDCM0024 | KB05 | Ramos | C63(1.75) | LDD2185 | [1] |