General Information of Target

Target ID LDTP05792
Target Name G protein pathway suppressor 2 (GPS2)
Gene Name GPS2
Gene ID 2874
Synonyms
G protein pathway suppressor 2; GPS-2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERM
SLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSL
TVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQF
QGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQ
TGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGK
SGFAATSQPGPRLPFIQHSQNPRFYHK
Target Bioclass
Other
Subcellular location
Nucleus
Function
Key regulator of inflammation, lipid metabolism and mitochondrion homeostasis that acts by inhibiting the activity of the ubiquitin-conjugating enzyme UBE2N/Ubc13, thereby inhibiting 'Lys-63'-linked ubiquitination. In the nucleus, can both acts as a corepressor and coactivator of transcription, depending on the context. Acts as a transcription coactivator in adipocytes by promoting the recruitment of PPARG to promoters: acts by inhibiting the activity of the ubiquitin-conjugating enzyme UBE2N/Ubc13, leading to stabilization of KDM4A and subsequent histone H3 'Lys-9' (H3K9) demethylation. Promotes cholesterol efflux by acting as a transcription coactivator. Acts as a regulator of B-cell development by inhibiting UBE2N/Ubc13, thereby restricting the activation of Toll-like receptors (TLRs) and B-cell antigen receptors (BCRs) signaling pathways. Acts as a key mediator of mitochondrial stress response: in response to mitochondrial depolarization, relocates from the mitochondria to the nucleus following desumoylation and specifically promotes expression of nuclear-encoded mitochondrial genes. Promotes transcription of nuclear-encoded mitochondrial genes by inhibiting UBE2N/Ubc13. Can also act as a corepressor as part of the N-Cor repressor complex by repressing active PPARG. Plays an anti-inflammatory role in macrophages and is required for insulin sensitivity by acting as a corepressor. Plays an anti-inflammatory role during the hepatic acute phase response by interacting with sumoylated NR1H2 and NR5A2 proteins, thereby preventing N-Cor corepressor complex dissociation. In the cytosol, also plays a non-transcriptional role by regulating insulin signaling and pro-inflammatory pathways. In the cytoplasm, acts as a negative regulator of inflammation by inhibiting the pro-inflammatory TNF-alpha pathway; acts by repressing UBE2N/Ubc13 activity. In the cytoplasm of adipocytes, restricts the activation of insulin signaling via inhibition of UBE2N/Ubc13-mediated ubiquitination of AKT. Able to suppress G-protein- and mitogen-activated protein kinase-mediated signal transduction. Acts as a tumor-suppressor in liposarcoma.; (Microbial infection) Required for efficient replication of hepatitis C virus (HCV) by promoting the interaction between VAPA and HCV virus protein NS5A.
Uniprot ID
Q13227
Ensemble ID
ENST00000380728.7
HGNC ID
HGNC:4550

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
22RV1 Deletion: p.S106Ter .
D283MED Deletion: p.Y164Ter .
FUOV1 Deletion: p.E33KfsTer6 .
HEC1 SNV: p.A203P .
KYM1 SNV: p.Q117L .
MFE319 SNV: p.L120P .
WM115 SNV: p.P195S .
WM2664 SNV: p.P195S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info 
K99(9.09)  LDD0277  [1]
Acrolein
 Probe Info 
N.A.  LDD0227  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0109  NEM HeLa N.A.  LDD0227  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Histone deacetylase 1 (HDAC1) Histone deacetylase family Q13547
Histone deacetylase 3 (HDAC3) Histone deacetylase family O15379
Integrator complex subunit 11 (INTS11) RNA-metabolizing metallo-beta-lactamase-like family Q5TA45
NADPH-dependent diflavin oxidoreductase 1 (NDOR1) NADPH-dependent diflavin oxidoreductase NDOR1 family; Flavodoxin family; Flavoprotein pyridine nucleotide cytochrome reductase family Q9UHB4
RalA-binding protein 1 (RALBP1) . Q15311
Ubiquitin domain-containing protein 2 (UBTD2) . Q8WUN7
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Cyclic AMP-dependent transcription factor ATF-4 (ATF4) BZIP family P18848
Cyclic AMP-dependent transcription factor ATF-5 (ATF5) BZIP family Q9Y2D1
POU domain class 2-associating factor 1 (POU2AF1) POU2AF family Q16633
Other
Click To Hide/Show 22 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
A-kinase anchor protein 8-like (AKAP8L) AKAP95 family Q9ULX6
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Keratin-associated protein 3-1 (KRTAP3-1) KRTAP type 3 family Q9BYR8
Keratin-associated protein 3-3 (KRTAP3-3) KRTAP type 3 family Q9BYR6
Keratin-associated protein 6-1 (KRTAP6-1) KRTAP type 6 family Q3LI64
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Protein Mis18-beta (OIP5) Mis18 family O43482
Keratin-associated protein 11-1 (KRTAP11-1) PMG family Q8IUC1
Keratin-associated protein 13-2 (KRTAP13-2) PMG family Q52LG2
SEC14 domain and spectrin repeat-containing protein 1 (SESTD1) SOLO family Q86VW0
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Vacuolar protein sorting-associated protein 37C (VPS37C) VPS37 family A5D8V6
Thyroid receptor-interacting protein 6 (TRIP6) Zyxin/ajuba family Q15654
BAG family molecular chaperone regulator 4 (BAG4) . O95429
DAZ-associated protein 2 (DAZAP2) . Q15038
Four and a half LIM domains protein 5 (FHL5) . Q5TD97
Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) . P31943
MAP3K7 C-terminal-like protein (MAP3K7CL) . P57077
RNA-binding protein with multiple splicing (RBPMS) . Q93062

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.