Details of the Target

General Information of Target

Target ID LDTP05740
Target Name TNF receptor-associated factor 1 (TRAF1)
Gene Name TRAF1
Gene ID 7185
Synonyms
EBI6; TNF receptor-associated factor 1; Epstein-Barr virus-induced protein 6
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGE
DLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST
Target Bioclass
Other
Function
Adapter molecule that regulates the activation of NF-kappa-B and JNK. Plays a role in the regulation of cell survival and apoptosis. The heterotrimer formed by TRAF1 and TRAF2 is part of a E3 ubiquitin-protein ligase complex that promotes ubiquitination of target proteins, such as MAP3K14. The TRAF1/TRAF2 complex recruits the antiapoptotic E3 protein-ubiquitin ligases BIRC2 and BIRC3 to TNFRSF1B/TNFR2.
Uniprot ID
Q13077
Ensemble ID
ENST00000373887.8
HGNC ID
HGNC:12031

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT15 SNV: p.A188V .
HT SNV: p.A361V .
MCC26 Substitution: p.A361V .
REH SNV: p.A369T .
SUPT1 SNV: p.A77S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
ONAyne
 Probe Info  		K193(8.33)  LDD0274  [2]
DBIA
 Probe Info  		C57(1.33)  LDD3323  [3]
IPM
 Probe Info  		C169(2.48)  LDD1701  [4]
CY-1
 Probe Info  		N.A.  LDD0246  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C280(2.83); C169(1.04); C37(0.95)  LDD1702  [4]
 LDCM0022  KB02 769-P C57(1.50)  LDD2246  [3]
 LDCM0023  KB03 MDA-MB-231 C169(2.48)  LDD1701  [4]
 LDCM0024  KB05 SKMEL24 C57(1.33)  LDD3323  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 36 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Maspardin (SPG21) AB hydrolase superfamily Q9NZD8
Putative protein FAM86C1P (FAM86C1P) EEF2KMT family Q9NVL1
3',5'-cyclic-AMP phosphodiesterase 4D (PDE4D) Cyclic nucleotide phosphodiesterase family Q08499
Cryptochrome-2 (CRY2) DNA photolyase class-1 family Q49AN0
Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial (ECH1) Enoyl-CoA hydratase/isomerase family Q13011
Peroxisomal bifunctional enzyme (EHHADH) Enoyl-CoA hydratase/isomerase family; 3-hydroxyacyl-CoA dehydrogenase family Q08426
Ribonuclease P/MRP protein subunit POP5 (POP5) Eukaryotic/archaeal RNase P protein component 2 family Q969H6
NADH-cytochrome b5 reductase 2 (CYB5R2) Flavoprotein pyridine nucleotide cytochrome reductase family Q6BCY4
Baculoviral IAP repeat-containing protein 2 (BIRC2) IAP family Q13490
Methyltransferase-like protein 17, mitochondrial (METTL17) Rsm22 family Q9H7H0
CASP8 and FADD-like apoptosis regulator (CFLAR) Peptidase C14A family O15519
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Proteasome subunit beta type-1 (PSMB1) Peptidase T1B family P20618
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Serine/threonine-protein kinase 3 (STK3) STE Ser/Thr protein kinase family Q13188
Receptor-interacting serine/threonine-protein kinase 1 (RIPK1) TKL Ser/Thr protein kinase family Q13546
Dual specificity protein phosphatase 13B (DUSP13B) Protein-tyrosine phosphatase family Q9UII6
Dual specificity protein phosphatase 21 (DUSP21) Protein-tyrosine phosphatase family Q9H596
Dual specificity protein phosphatase 4 (DUSP4) Protein-tyrosine phosphatase family Q13115
RIPOR family member 3 (RIPOR3) RIPOR family Q96MK2
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
GTP-binding protein GEM (GEM) RGK family P55040
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
TNF receptor-associated factor 6 (TRAF6) TNF receptor-associated factor family Q9Y4K3
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
BRCA1-associated RING domain protein 1 (BARD1) . Q99728
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Germ cell-less protein-like 2 (GMCL2) . Q8NEA9
Glutaredoxin-3 (GLRX3) . O76003
Histone-lysine N-methyltransferase PRDM7 (PRDM7) . Q9NQW5
Josephin-1 (JOSD1) . Q15040
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) . Q13526
Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (SSC5D) . A1L4H1
Transporter and channel
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cytochrome c oxidase subunit 5B, mitochondrial (COX5B) Cytochrome c oxidase subunit 5B family P10606
Hairy/enhancer-of-split related with YRPW motif protein 2 (HEY2) HEY family Q9UBP5
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
ADP/ATP translocase 3 (SLC25A6) Mitochondrial carrier (TC 2.A.29) family P12236
Solute carrier family 25 member 48 (SLC25A48) Mitochondrial carrier (TC 2.A.29) family Q6ZT89
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 43 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-D12 (HOXD12) Abd-B homeobox family P35452
Homeobox protein Hox-B5 (HOXB5) Antp homeobox family P09067
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Transcription factor AP-2-delta (TFAP2D) AP-2 family Q7Z6R9
Fos-related antigen 2 (FOSL2) BZIP family P15408
Transcription factor COE2 (EBF2) COE family Q9HAK2
Doublesex- and mab-3-related transcription factor 3 (DMRT3) DMRT family Q9NQL9
Zinc finger protein ZIC 1 (ZIC1) GLI C2H2-type zinc-finger protein family Q15915
Vascular endothelial zinc finger 1 (VEZF1) Krueppel C2H2-type zinc-finger protein family Q14119
Zinc finger and BTB domain-containing protein 16 (ZBTB16) Krueppel C2H2-type zinc-finger protein family Q05516
Zinc finger protein 124 (ZNF124) Krueppel C2H2-type zinc-finger protein family Q15973
Zinc finger protein 20 (ZNF20) Krueppel C2H2-type zinc-finger protein family P17024
Zinc finger protein 23 (ZNF23) Krueppel C2H2-type zinc-finger protein family P17027
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 440 (ZNF440) Krueppel C2H2-type zinc-finger protein family Q8IYI8
Zinc finger protein 490 (ZNF490) Krueppel C2H2-type zinc-finger protein family Q9ULM2
Zinc finger protein 502 (ZNF502) Krueppel C2H2-type zinc-finger protein family Q8TBZ5
Zinc finger protein 512B (ZNF512B) Krueppel C2H2-type zinc-finger protein family Q96KM6
Zinc finger protein 564 (ZNF564) Krueppel C2H2-type zinc-finger protein family Q8TBZ8
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Zinc finger protein 627 (ZNF627) Krueppel C2H2-type zinc-finger protein family Q7L945
Zinc finger protein 648 (ZNF648) Krueppel C2H2-type zinc-finger protein family Q5T619
Zinc finger protein 669 (ZNF669) Krueppel C2H2-type zinc-finger protein family Q96BR6
Zinc finger protein 844 (ZNF844) Krueppel C2H2-type zinc-finger protein family Q08AG5
Pituitary homeobox 1 (PITX1) Paired homeobox family P78337
Teashirt homolog 2 (TSHZ2) Teashirt C2H2-type zinc-finger protein family Q9NRE2
AT-rich interactive domain-containing protein 5A (ARID5A) . Q03989
B-cell lymphoma 6 protein (BCL6) . P41182
Chorion-specific transcription factor GCMb (GCM2) . O75603
Endothelial transcription factor GATA-2 (GATA2) . P23769
Ligand-dependent corepressor (LCOR) . Q96JN0
Mesogenin-1 (MSGN1) . A6NI15
Oligodendrocyte transcription factor 3 (OLIG3) . Q7RTU3
Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1 (SOHLH1) . Q5JUK2
T-box transcription factor TBX18 (TBX18) . O95935
THAP domain-containing protein 7 (THAP7) . Q9BT49
Transcription factor AP-4 (TFAP4) . Q01664
Transcriptional enhancer factor TEF-3 (TEAD4) . Q15561
Transcriptional regulator QRICH1 (QRICH1) . Q2TAL8
Transcriptional repressor p66-beta (GATAD2B) . Q8WXI9
Zinc finger protein 581 (ZNF581) . Q9P0T4
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Leucine-rich repeat neuronal protein 1 (LRRN1) . Q6UXK5
Other
Click To Hide/Show 72 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-actinin-3 (ACTN3) Alpha-actinin family Q08043
Apoptosis-stimulating of p53 protein 1 (PPP1R13B) ASPP family Q96KQ4
Protein BEX2 (BEX2) BEX family Q9BXY8
Cyclin-dependent kinase inhibitor 1 (CDKN1A) CDI family P38936
Cyclin-dependent kinase 4 inhibitor B (CDKN2B) CDKN2 cyclin-dependent kinase inhibitor family P42772
Docking protein 3 (DOK3) DOK family Q7L591
EF-hand calcium-binding domain-containing protein 4B (CRACR2A) EFCAB4 family Q9BSW2
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM161B (FAM161B) FAM161 family Q96MY7
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 (GNG5) G protein gamma family P63218
Golgi reassembly-stacking protein 2 (GORASP2) GORASP family Q9H8Y8
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Keratin, type II cytoskeletal 3 (KRT3) Intermediate filament family P12035
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Microtubule-associated protein RP/EB family member 2 (MAPRE2) MAPRE family Q15555
MICOS complex subunit MIC19 (CHCHD3) MICOS complex subunit Mic19 family Q9NX63
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
Myozenin-1 (MYOZ1) Myozenin family Q9NP98
Putative POM121-like protein 1 (POM121L1P) POM121 family Q3SYA9
Protein ripply1 (RIPPLY1) Ripply family Q0D2K3
RNA-binding protein EWS (EWSR1) RRM TET family Q01844
Shiftless antiviral inhibitor of ribosomal frameshifting protein (SHFL) SHFL family Q9NUL5
SNW domain-containing protein 1 (SNW1) SNW family Q13573
Synaptonemal complex central element protein 1 (SYCE1) SYCE family Q8N0S2
T-cell leukemia/lymphoma protein 1A (TCL1A) TCL1 family P56279
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
U5 small nuclear ribonucleoprotein TSSC4 (TSSC4) TSSC4 family Q9Y5U2
Macrophage immunometabolism regulator (MACIR) UNC119-binding protein family Q96GV9
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
U3 small nucleolar RNA-associated protein 14 homolog C (UTP14C) UTP14 family Q5TAP6
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
Zinc finger C2HC domain-containing protein 1C (ZC2HC1C) ZC2HC1 family Q53FD0
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
APOBEC1 complementation factor (A1CF) . Q9NQ94
ARF GTPase-activating protein GIT2 (GIT2) . Q14161
Calcium-regulated heat-stable protein 1 (CARHSP1) . Q9Y2V2
Cation channel sperm-associated targeting subunit tau (C2CD6) . Q53TS8
Cell division cycle-associated protein 3 (CDCA3) . Q99618
Coiled-coil domain-containing protein 116 (CCDC116) . Q8IYX3
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Coiled-coil domain-containing protein 185 (CCDC185) . Q8N715
DEP domain-containing mTOR-interacting protein (DEPTOR) . Q8TB45
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
Factor associated with metabolism and energy (CCDC198) . Q9NVL8
FMR1-interacting protein NUFIP2 (NUFIP2) . Q7Z417
Grancalcin (GCA) . P28676
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Heterogeneous nuclear ribonucleoprotein M (HNRNPM) . P52272
Kelch-like protein 38 (KLHL38) . Q2WGJ6
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Lamin tail domain-containing protein 2 (LMNTD2) . Q8IXW0
Matrin-3 (MATR3) . P43243
MORN repeat-containing protein 3 (MORN3) . Q6PF18
Nebulette (NEBL) . O76041
PHD finger protein 21A (PHF21A) . Q96BD5
Pleckstrin homology domain-containing family N member 1 (PLEKHN1) . Q494U1
Protein lin-37 homolog (LIN37) . Q96GY3
Protein SPMIP2 (SPMIP2) . Q96LM5
Putative uncharacterized protein MGC163334 . Q5W150
Ras association domain-containing protein 5 (RASSF5) . Q8WWW0
Ras GTPase-activating protein nGAP (RASAL2) . Q9UJF2
Receptor-transporting protein 5 (RTP5) . Q14D33
RNA-binding protein 41 (RBM41) . Q96IZ5
RNA-binding protein 45 (RBM45) . Q8IUH3
SHC-transforming protein 3 (SHC3) . Q92529
Spermatogenesis-associated protein 46 (SPATA46) . Q5T0L3
Sterile alpha motif domain-containing protein 11 (SAMD11) . Q96NU1
TBC1 domain family member 8 (TBC1D8) . O95759
TNF receptor-associated factor 1 (TRAF1) . Q13077
U11/U12 small nuclear ribonucleoprotein 25 kDa protein (SNRNP25) . Q9BV90
WW domain-containing adapter protein with coiled-coil (WAC) . Q9BTA9
Zinc finger FYVE domain-containing protein 21 (ZFYVE21) . Q9BQ24

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
5 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.