Details of the Target
General Information of Target
Target ID | LDTP05694 | |||||
---|---|---|---|---|---|---|
Target Name | Killer cell lectin-like receptor subfamily B member 1 (KLRB1) | |||||
Gene Name | KLRB1 | |||||
Gene ID | 3820 | |||||
Synonyms |
CLEC5B; NKRP1A; Killer cell lectin-like receptor subfamily B member 1; C-type lectin domain family 5 member B; HNKR-P1a; NKR-P1A; Natural killer cell surface protein P1A; CD antigen CD161 |
|||||
3D Structure | ||||||
Sequence |
MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSV
SVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLA DCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEI RGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS |
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Membrane
|
|||||
Function |
Plays an inhibitory role on natural killer (NK) cells cytotoxicity. Activation results in specific acid sphingomyelinase/SMPD1 stimulation with subsequent marked elevation of intracellular ceramide. Activation also leads to AKT1/PKB and RPS6KA1/RSK1 kinases stimulation as well as markedly enhanced T-cell proliferation induced by anti-CD3. Acts as a lectin that binds to the terminal carbohydrate Gal-alpha(1,3)Gal epitope as well as to the N-acetyllactosamine epitope. Binds also to CLEC2D/LLT1 as a ligand and inhibits NK cell-mediated cytotoxicity as well as interferon-gamma secretion in target cells.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
C74(5.03) | LDD1709 | [1] |
Competitor(s) Related to This Target