Details of the Target
General Information of Target
| Target ID | LDTP05653 | |||||
|---|---|---|---|---|---|---|
| Target Name | Centrin-1 (CETN1) | |||||
| Gene Name | CETN1 | |||||
| Gene ID | 1068 | |||||
| Synonyms |
CEN1; CETN; Centrin-1; Caltractin isoform 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRAL
GFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGK ISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Centrin family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
|
|||||
| Function | Plays a fundamental role in microtubule-organizing center structure and function. Plays a role in sperm cilia formation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ATP probe Probe Info |
 |
N.A. | LDD0199 | [1] | |
The Interaction Atlas With This Target